Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 290847..291431 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP104336 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01408 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | N8Q7V3 |
| Locus tag | N4T40_RS21620 | Protein ID | WP_000286964.1 |
| Coordinates | 291129..291431 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N4T40_RS21615 | Protein ID | WP_000985609.1 |
| Coordinates | 290847..291128 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T40_RS21585 (N4T40_21585) | 285914..286525 | + | 612 | WP_015060246.1 | recombinase family protein | - |
| N4T40_RS21590 (N4T40_21590) | 286715..287599 | - | 885 | WP_000155092.1 | Mph(E) family macrolide 2'-phosphotransferase | - |
| N4T40_RS21595 (N4T40_21595) | 287655..289130 | - | 1476 | WP_000052512.1 | ABC-F type ribosomal protection protein Msr(E) | - |
| N4T40_RS21600 (N4T40_21600) | 289623..289895 | - | 273 | WP_000369781.1 | NadS family protein | - |
| N4T40_RS21605 (N4T40_21605) | 289888..290208 | - | 321 | WP_000897307.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N4T40_RS21610 (N4T40_21610) | 290348..290767 | + | 420 | WP_001180106.1 | SMI1/KNR4 family protein | - |
| N4T40_RS21615 (N4T40_21615) | 290847..291128 | - | 282 | WP_000985609.1 | putative addiction module antidote protein | Antitoxin |
| N4T40_RS21620 (N4T40_21620) | 291129..291431 | - | 303 | WP_000286964.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4T40_RS21625 (N4T40_21625) | 291633..292601 | - | 969 | WP_252513945.1 | IS30 family transposase | - |
| N4T40_RS21630 (N4T40_21630) | 292679..293122 | + | 444 | WP_260744098.1 | hypothetical protein | - |
| N4T40_RS21635 (N4T40_21635) | 293289..293603 | - | 315 | WP_004728120.1 | BrnA antitoxin family protein | - |
| N4T40_RS21640 (N4T40_21640) | 293590..293877 | - | 288 | WP_000438825.1 | BrnT family toxin | - |
| N4T40_RS21645 (N4T40_21645) | 294067..294903 | - | 837 | WP_040110386.1 | APH(6)-I family aminoglycoside O-phosphotransferase | - |
| N4T40_RS21650 (N4T40_21650) | 294903..295706 | - | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| N4T40_RS21655 (N4T40_21655) | 295772..296386 | - | 615 | WP_125281634.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / tet(X3) / blaOXA-58 / aph(3')-VI / blaNDM-1 / sul1 / qacE / ARR-3 / mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib | - | 1..328511 | 328511 | |
| - | inside | IScluster/Tn | mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib | - | 286715..304544 | 17829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11573.07 Da Isoelectric Point: 4.6838
>T257681 WP_000286964.1 NZ_CP104336:c291431-291129 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|