Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2516497..2517176 | Replicon | chromosome |
| Accession | NZ_CP104335 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01408 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2S4SYJ5 |
| Locus tag | N4T40_RS12330 | Protein ID | WP_002108505.1 |
| Coordinates | 2516497..2516679 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N4T40_RS12335 | Protein ID | WP_000966688.1 |
| Coordinates | 2516772..2517176 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T40_RS12290 (N4T40_12290) | 2511651..2512058 | + | 408 | WP_000255076.1 | hypothetical protein | - |
| N4T40_RS12295 (N4T40_12295) | 2512030..2512398 | + | 369 | WP_025466445.1 | hypothetical protein | - |
| N4T40_RS12300 (N4T40_12300) | 2512400..2512798 | + | 399 | WP_025466443.1 | phage tail terminator-like protein | - |
| N4T40_RS12305 (N4T40_12305) | 2512800..2513018 | + | 219 | WP_001277694.1 | hypothetical protein | - |
| N4T40_RS12310 (N4T40_12310) | 2513114..2513467 | + | 354 | WP_031975507.1 | hypothetical protein | - |
| N4T40_RS12315 (N4T40_12315) | 2513467..2514615 | + | 1149 | WP_033841386.1 | hypothetical protein | - |
| N4T40_RS12320 (N4T40_12320) | 2514668..2515585 | + | 918 | WP_000094249.1 | phage tail tube protein | - |
| N4T40_RS12325 (N4T40_12325) | 2515655..2516170 | + | 516 | WP_001185610.1 | hypothetical protein | - |
| N4T40_RS12330 (N4T40_12330) | 2516497..2516679 | + | 183 | WP_002108505.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4T40_RS12335 (N4T40_12335) | 2516772..2517176 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4T40_RS12340 (N4T40_12340) | 2517275..2517451 | + | 177 | WP_075149899.1 | hypothetical protein | - |
| N4T40_RS12345 (N4T40_12345) | 2517460..2517783 | + | 324 | WP_000523928.1 | DUF4236 domain-containing protein | - |
| N4T40_RS12350 (N4T40_12350) | 2517816..2518199 | + | 384 | WP_000725050.1 | hypothetical protein | - |
| N4T40_RS12355 (N4T40_12355) | 2518261..2519007 | + | 747 | WP_000599536.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2484229..2535314 | 51085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6685.80 Da Isoelectric Point: 10.5523
>T257679 WP_002108505.1 NZ_CP104335:2516497-2516679 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257679 WP_000966688.1 NZ_CP104335:2516772-2517176 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4SYJ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9L2H6 |