Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 776445..777098 | Replicon | chromosome |
| Accession | NZ_CP104335 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01408 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A427QZH0 |
| Locus tag | N4T40_RS04080 | Protein ID | WP_000931891.1 |
| Coordinates | 776445..776834 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | N4T40_RS04085 | Protein ID | WP_001288210.1 |
| Coordinates | 776841..777098 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T40_RS04065 (N4T40_04065) | 771563..773758 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
| N4T40_RS04070 (N4T40_04070) | 773946..774512 | - | 567 | WP_000651536.1 | rhombosortase | - |
| N4T40_RS04075 (N4T40_04075) | 774590..775675 | - | 1086 | WP_000049104.1 | hypothetical protein | - |
| N4T40_RS04080 (N4T40_04080) | 776445..776834 | - | 390 | WP_000931891.1 | hypothetical protein | Toxin |
| N4T40_RS04085 (N4T40_04085) | 776841..777098 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| N4T40_RS04090 (N4T40_04090) | 777286..778458 | + | 1173 | WP_001190558.1 | acyl-CoA dehydrogenase family protein | - |
| N4T40_RS04095 (N4T40_04095) | 778508..779998 | - | 1491 | WP_000415132.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| N4T40_RS04100 (N4T40_04100) | 780180..780557 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| N4T40_RS04105 (N4T40_04105) | 780576..781583 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15635.91 Da Isoelectric Point: 10.3890
>T257678 WP_000931891.1 NZ_CP104335:c776834-776445 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A427QZH0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BQM7 |