Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 61480..62123 | Replicon | plasmid pHB42-F3 |
| Accession | NZ_CP104331 | ||
| Organism | Escherichia coli strain THB42-F3 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | N0544_RS22685 | Protein ID | WP_001044768.1 |
| Coordinates | 61480..61896 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | N0544_RS22690 | Protein ID | WP_001261287.1 |
| Coordinates | 61893..62123 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0544_RS22670 (57979) | 57979..58569 | - | 591 | WP_000194575.1 | hypothetical protein | - |
| N0544_RS22675 (58569) | 58569..58826 | - | 258 | WP_000343085.1 | hypothetical protein | - |
| N0544_RS22680 (59180) | 59180..61318 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
| N0544_RS22685 (61480) | 61480..61896 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N0544_RS22690 (61893) | 61893..62123 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N0544_RS22695 (62419) | 62419..62709 | + | 291 | WP_000111771.1 | hypothetical protein | - |
| N0544_RS22700 (62699) | 62699..63598 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| N0544_RS22705 (63648) | 63648..65873 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| N0544_RS22710 (65875) | 65875..66963 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / mph(A) / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaTEM-1B / rmtB / blaCTX-M-55 | - | 1..161931 | 161931 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T257674 WP_001044768.1 NZ_CP104331:c61896-61480 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |