Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3523390..3524069 | Replicon | chromosome |
| Accession | NZ_CP104330 | ||
| Organism | Escherichia coli strain THB42-F3 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | N0544_RS17175 | Protein ID | WP_000854672.1 |
| Coordinates | 3523390..3523731 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | N0544_RS17180 | Protein ID | WP_000070395.1 |
| Coordinates | 3523752..3524069 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0544_RS17150 (3518976) | 3518976..3519068 | + | 93 | Protein_3350 | sigma factor-binding protein Crl | - |
| N0544_RS17155 (3519107) | 3519107..3520162 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| N0544_RS17160 (3520450) | 3520450..3521553 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| N0544_RS17165 (3521565) | 3521565..3522818 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| N0544_RS17175 (3523390) | 3523390..3523731 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| N0544_RS17180 (3523752) | 3523752..3524069 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| N0544_RS17185 (3524088) | 3524088..3524309 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| N0544_RS17190 (3524318) | 3524318..3524794 | - | 477 | WP_000811693.1 | RadC family protein | - |
| N0544_RS17195 (3524810) | 3524810..3525268 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| N0544_RS17200 (3525366) | 3525366..3525605 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
| N0544_RS17205 (3525682) | 3525682..3526149 | - | 468 | WP_001547765.1 | protein YkfB | - |
| N0544_RS17210 (3526172) | 3526172..3526615 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
| N0544_RS17215 (3526615) | 3526615..3526791 | - | 177 | WP_001285112.1 | hypothetical protein | - |
| N0544_RS17220 (3526838) | 3526838..3527029 | - | 192 | Protein_3363 | DeoR family transcriptional regulator | - |
| N0544_RS17225 (3527246) | 3527246..3528067 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| N0544_RS17230 (3528159) | 3528159..3529022 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T257664 WP_000854672.1 NZ_CP104330:c3523731-3523390 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|