Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2369536..2370174 | Replicon | chromosome |
Accession | NZ_CP104330 | ||
Organism | Escherichia coli strain THB42-F3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N0544_RS11480 | Protein ID | WP_000813794.1 |
Coordinates | 2369998..2370174 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N0544_RS11475 | Protein ID | WP_001270286.1 |
Coordinates | 2369536..2369952 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0544_RS11455 (2364688) | 2364688..2365629 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
N0544_RS11460 (2365630) | 2365630..2366643 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
N0544_RS11465 (2366661) | 2366661..2367806 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N0544_RS11470 (2368051) | 2368051..2369457 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N0544_RS11475 (2369536) | 2369536..2369952 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N0544_RS11480 (2369998) | 2369998..2370174 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N0544_RS11485 (2370396) | 2370396..2370626 | + | 231 | WP_000494244.1 | YncJ family protein | - |
N0544_RS11490 (2370718) | 2370718..2372679 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N0544_RS11495 (2372752) | 2372752..2373288 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N0544_RS11500 (2373380) | 2373380..2374555 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257662 WP_000813794.1 NZ_CP104330:c2370174-2369998 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257662 WP_001270286.1 NZ_CP104330:c2369952-2369536 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|