Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 71943..72535 Replicon plasmid pHB42-F2
Accession NZ_CP104329
Organism Escherichia coli strain THB42-F2

Toxin (Protein)


Gene name hicA Uniprot ID A0A1I9ZJC5
Locus tag N0499_RS22765 Protein ID WP_000513532.1
Coordinates 71943..72191 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A1I9ZJ49
Locus tag N0499_RS22770 Protein ID WP_000681609.1
Coordinates 72188..72535 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0499_RS22730 (N0499_22730) 66955..67620 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
N0499_RS22735 (N0499_22735) 68209..68538 + 330 WP_001542022.1 hypothetical protein -
N0499_RS22740 (N0499_22740) 68939..69454 + 516 WP_001025393.1 J domain-containing protein -
N0499_RS22745 (N0499_22745) 69558..70100 + 543 WP_001083904.1 hypothetical protein -
N0499_RS22750 (N0499_22750) 70097..70351 + 255 WP_001230709.1 hypothetical protein -
N0499_RS22755 (N0499_22755) 70348..70590 + 243 WP_000151456.1 hypothetical protein -
N0499_RS22760 (N0499_22760) 71161..71454 + 294 WP_000673428.1 hypothetical protein -
N0499_RS22765 (N0499_22765) 71943..72191 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin Toxin
N0499_RS22770 (N0499_22770) 72188..72535 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N0499_RS22775 (N0499_22775) 72623..73066 - 444 WP_023223351.1 hypothetical protein -
N0499_RS22780 (N0499_22780) 73307..73606 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
N0499_RS22785 (N0499_22785) 73866..74192 - 327 WP_000206697.1 hypothetical protein -
N0499_RS22790 (N0499_22790) 74194..74517 - 324 WP_223666488.1 hypothetical protein -
N0499_RS22795 (N0499_22795) 74494..74634 - 141 Protein_89 hypothetical protein -
N0499_RS22800 (N0499_22800) 74654..75361 - 708 WP_000108794.1 hypothetical protein -
N0499_RS22805 (N0499_22805) 75363..76115 - 753 WP_000797966.1 conjugal transfer protein TraL -
N0499_RS22810 (N0499_22810) 76133..76534 - 402 WP_021575837.1 hypothetical protein -
N0499_RS22815 (N0499_22815) 76902..77243 + 342 WP_000730722.1 plasmid mobilization relaxosome protein MobC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / aph(3')-IIa / mcr-1.1 - 1..123517 123517


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9378.03 Da        Isoelectric Point: 10.4800

>T257645 WP_000513532.1 NZ_CP104329:71943-72191 [Escherichia coli]
MGKADKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
VL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13206.97 Da        Isoelectric Point: 4.8313

>AT257645 WP_000681609.1 NZ_CP104329:72188-72535 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNILYGKLAFIRDLVTYEAETLADLEREFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSHHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I9ZJC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1I9ZJ49

References