257644

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 70097..70590 Replicon plasmid pHB42-F2
Accession NZ_CP104329
Organism Escherichia coli strain THB42-F2

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag N0499_RS22750 Protein ID WP_001230709.1
Coordinates 70097..70351 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag N0499_RS22755 Protein ID WP_000151456.1
Coordinates 70348..70590 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0499_RS22710 (N0499_22710) 65614..65766 + 153 Protein_72 FlmC family protein -
N0499_RS22715 (N0499_22715) 65714..65833 + 120 WP_229002406.1 Hok/Gef family protein -
N0499_RS22720 (N0499_22720) 65983..66579 + 597 WP_000125165.1 ProQ/FINO family protein -
N0499_RS22725 (N0499_22725) 66597..66881 - 285 WP_001162371.1 hypothetical protein -
N0499_RS22730 (N0499_22730) 66955..67620 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
N0499_RS22735 (N0499_22735) 68209..68538 + 330 WP_001542022.1 hypothetical protein -
N0499_RS22740 (N0499_22740) 68939..69454 + 516 WP_001025393.1 J domain-containing protein -
N0499_RS22745 (N0499_22745) 69558..70100 + 543 WP_001083904.1 hypothetical protein -
N0499_RS22750 (N0499_22750) 70097..70351 + 255 WP_001230709.1 hypothetical protein Toxin
N0499_RS22755 (N0499_22755) 70348..70590 + 243 WP_000151456.1 hypothetical protein Antitoxin
N0499_RS22760 (N0499_22760) 71161..71454 + 294 WP_000673428.1 hypothetical protein -
N0499_RS22765 (N0499_22765) 71943..72191 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
N0499_RS22770 (N0499_22770) 72188..72535 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
N0499_RS22775 (N0499_22775) 72623..73066 - 444 WP_023223351.1 hypothetical protein -
N0499_RS22780 (N0499_22780) 73307..73606 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
N0499_RS22785 (N0499_22785) 73866..74192 - 327 WP_000206697.1 hypothetical protein -
N0499_RS22790 (N0499_22790) 74194..74517 - 324 WP_223666488.1 hypothetical protein -
N0499_RS22795 (N0499_22795) 74494..74634 - 141 Protein_89 hypothetical protein -
N0499_RS22800 (N0499_22800) 74654..75361 - 708 WP_000108794.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / aph(3')-IIa / mcr-1.1 - 1..123517 123517


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T257644 WP_001230709.1 NZ_CP104329:70097-70351 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT257644 WP_000151456.1 NZ_CP104329:70348-70590 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References