Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 41106..41749 | Replicon | plasmid pHB42-F2 |
Accession | NZ_CP104329 | ||
Organism | Escherichia coli strain THB42-F2 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | N0499_RS22585 | Protein ID | WP_001044768.1 |
Coordinates | 41106..41522 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | N0499_RS22590 | Protein ID | WP_001261287.1 |
Coordinates | 41519..41749 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0499_RS22570 (N0499_22570) | 37605..38195 | - | 591 | WP_000194575.1 | hypothetical protein | - |
N0499_RS22575 (N0499_22575) | 38195..38452 | - | 258 | WP_000343085.1 | hypothetical protein | - |
N0499_RS22580 (N0499_22580) | 38806..40944 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
N0499_RS22585 (N0499_22585) | 41106..41522 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0499_RS22590 (N0499_22590) | 41519..41749 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0499_RS22595 (N0499_22595) | 42045..42335 | + | 291 | WP_000111771.1 | hypothetical protein | - |
N0499_RS22600 (N0499_22600) | 42325..43224 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
N0499_RS22605 (N0499_22605) | 43274..45499 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
N0499_RS22610 (N0499_22610) | 45501..46589 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / aph(3')-IIa / mcr-1.1 | - | 1..123517 | 123517 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T257643 WP_001044768.1 NZ_CP104329:c41522-41106 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |