Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3949912..3950726 | Replicon | chromosome |
Accession | NZ_CP104328 | ||
Organism | Escherichia coli strain THB42-F2 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | N0499_RS19260 | Protein ID | WP_001054376.1 |
Coordinates | 3949912..3950169 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | N0499_RS19265 | Protein ID | WP_001309181.1 |
Coordinates | 3950181..3950726 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0499_RS19235 (3945200) | 3945200..3946306 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
N0499_RS19240 (3946371) | 3946371..3947351 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
N0499_RS19245 (3947461) | 3947461..3947666 | + | 206 | Protein_3758 | HNH endonuclease | - |
N0499_RS19250 (3947934) | 3947934..3949174 | - | 1241 | Protein_3759 | helicase YjhR | - |
N0499_RS19255 (3949290) | 3949290..3949421 | + | 132 | WP_001309182.1 | hypothetical protein | - |
N0499_RS19260 (3949912) | 3949912..3950169 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
N0499_RS19265 (3950181) | 3950181..3950726 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
N0499_RS19270 (3950782) | 3950782..3951528 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
N0499_RS19275 (3951697) | 3951697..3951915 | + | 219 | Protein_3764 | hypothetical protein | - |
N0499_RS19280 (3951953) | 3951953..3952069 | + | 117 | Protein_3765 | VOC family protein | - |
N0499_RS19285 (3952314) | 3952314..3953435 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
N0499_RS19290 (3953432) | 3953432..3953710 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
N0499_RS19295 (3953722) | 3953722..3955035 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimI / fimA / fimE / fimB | 3938922..3958950 | 20028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T257639 WP_001054376.1 NZ_CP104328:3949912-3950169 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT257639 WP_001309181.1 NZ_CP104328:3950181-3950726 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|