Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3522494..3523173 Replicon chromosome
Accession NZ_CP104328
Organism Escherichia coli strain THB42-F2

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag N0499_RS17165 Protein ID WP_000854672.1
Coordinates 3522494..3522835 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag N0499_RS17170 Protein ID WP_000070395.1
Coordinates 3522856..3523173 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0499_RS17140 (3518080) 3518080..3518172 + 93 Protein_3348 sigma factor-binding protein Crl -
N0499_RS17145 (3518211) 3518211..3519266 - 1056 WP_000749863.1 phosphoporin PhoE -
N0499_RS17150 (3519554) 3519554..3520657 + 1104 WP_001285288.1 glutamate 5-kinase -
N0499_RS17155 (3520669) 3520669..3521922 + 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
N0499_RS17165 (3522494) 3522494..3522835 - 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
N0499_RS17170 (3522856) 3522856..3523173 - 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
N0499_RS17175 (3523192) 3523192..3523413 - 222 WP_000691994.1 DUF987 domain-containing protein -
N0499_RS17180 (3523422) 3523422..3523898 - 477 WP_000811693.1 RadC family protein -
N0499_RS17185 (3523914) 3523914..3524372 - 459 WP_000211838.1 antirestriction protein -
N0499_RS17190 (3524470) 3524470..3524709 - 240 WP_000194654.1 DUF905 family protein -
N0499_RS17195 (3524786) 3524786..3525253 - 468 WP_001547765.1 protein YkfB -
N0499_RS17200 (3525276) 3525276..3525719 - 444 WP_000824223.1 lipoprotein YafY -
N0499_RS17205 (3525719) 3525719..3525895 - 177 WP_001285112.1 hypothetical protein -
N0499_RS17210 (3525942) 3525942..3526133 - 192 Protein_3361 DeoR family transcriptional regulator -
N0499_RS17215 (3526350) 3526350..3527171 - 822 WP_000197389.1 DUF932 domain-containing protein -
N0499_RS17220 (3527263) 3527263..3528126 - 864 WP_001065553.1 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3517374..3556187 38813


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T257634 WP_000854672.1 NZ_CP104328:c3522835-3522494 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT257634 WP_000070395.1 NZ_CP104328:c3523173-3522856 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References