Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2369839..2370477 | Replicon | chromosome |
| Accession | NZ_CP104328 | ||
| Organism | Escherichia coli strain THB42-F2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | N0499_RS11480 | Protein ID | WP_000813794.1 |
| Coordinates | 2370301..2370477 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N0499_RS11475 | Protein ID | WP_001270286.1 |
| Coordinates | 2369839..2370255 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0499_RS11455 (2364991) | 2364991..2365932 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| N0499_RS11460 (2365933) | 2365933..2366946 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| N0499_RS11465 (2366964) | 2366964..2368109 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| N0499_RS11470 (2368354) | 2368354..2369760 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| N0499_RS11475 (2369839) | 2369839..2370255 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N0499_RS11480 (2370301) | 2370301..2370477 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N0499_RS11485 (2370699) | 2370699..2370929 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| N0499_RS11490 (2371021) | 2371021..2372982 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N0499_RS11495 (2373055) | 2373055..2373591 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| N0499_RS11500 (2373644) | 2373644..2374858 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257632 WP_000813794.1 NZ_CP104328:c2370477-2370301 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257632 WP_001270286.1 NZ_CP104328:c2370255-2369839 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|