Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1802596..1803427 | Replicon | chromosome |
| Accession | NZ_CP104328 | ||
| Organism | Escherichia coli strain THB42-F2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | N0499_RS08580 | Protein ID | WP_000854814.1 |
| Coordinates | 1802596..1802970 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | N0499_RS08585 | Protein ID | WP_001285584.1 |
| Coordinates | 1803059..1803427 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0499_RS08540 (1797992) | 1797992..1799158 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| N0499_RS08545 (1799277) | 1799277..1799750 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| N0499_RS08550 (1799948) | 1799948..1801006 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| N0499_RS08555 (1801178) | 1801178..1801507 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| N0499_RS08560 (1801608) | 1801608..1801742 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| N0499_RS08565 (1801862) | 1801862..1801990 | + | 129 | Protein_1672 | transposase domain-containing protein | - |
| N0499_RS08570 (1802279) | 1802279..1802359 | - | 81 | Protein_1673 | hypothetical protein | - |
| N0499_RS08575 (1802405) | 1802405..1802599 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| N0499_RS08580 (1802596) | 1802596..1802970 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| N0499_RS08585 (1803059) | 1803059..1803427 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N0499_RS08590 (1803501) | 1803501..1803722 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| N0499_RS08595 (1803785) | 1803785..1804231 | - | 447 | WP_000187523.1 | RadC family protein | - |
| N0499_RS08600 (1804228) | 1804228..1805760 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T257625 WP_000854814.1 NZ_CP104328:c1802970-1802596 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT257625 WP_001285584.1 NZ_CP104328:c1803427-1803059 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |