Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 64169..64812 | Replicon | plasmid pHB42-F1 |
Accession | NZ_CP104327 | ||
Organism | Escherichia coli strain THB42-F1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | N0470_RS22915 | Protein ID | WP_001044768.1 |
Coordinates | 64169..64585 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | N0470_RS22920 | Protein ID | WP_001261287.1 |
Coordinates | 64582..64812 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0470_RS22900 (60668) | 60668..61258 | - | 591 | WP_000194575.1 | hypothetical protein | - |
N0470_RS22905 (61258) | 61258..61515 | - | 258 | WP_000343085.1 | hypothetical protein | - |
N0470_RS22910 (61869) | 61869..64007 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
N0470_RS22915 (64169) | 64169..64585 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0470_RS22920 (64582) | 64582..64812 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0470_RS22925 (65108) | 65108..65398 | + | 291 | WP_000111771.1 | hypothetical protein | - |
N0470_RS22930 (65388) | 65388..66287 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
N0470_RS22935 (66337) | 66337..68562 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
N0470_RS22940 (68564) | 68564..69652 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / rmtB / blaCTX-M-55 | - | 1..162761 | 162761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T257613 WP_001044768.1 NZ_CP104327:c64585-64169 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |