Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3621429..3622108 Replicon chromosome
Accession NZ_CP104326
Organism Escherichia coli strain THB42-F1

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag N0470_RS17730 Protein ID WP_000854672.1
Coordinates 3621767..3622108 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag N0470_RS17725 Protein ID WP_000070395.1
Coordinates 3621429..3621746 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0470_RS17675 (3616476) 3616476..3617339 + 864 WP_001065553.1 GTPase family protein -
N0470_RS17680 (3617431) 3617431..3618252 + 822 WP_000197389.1 DUF932 domain-containing protein -
N0470_RS17685 (3618469) 3618469..3618660 + 192 Protein_3457 DeoR family transcriptional regulator -
N0470_RS17690 (3618707) 3618707..3618883 + 177 WP_001285112.1 hypothetical protein -
N0470_RS17695 (3618883) 3618883..3619326 + 444 WP_000824223.1 lipoprotein YafY -
N0470_RS17700 (3619349) 3619349..3619816 + 468 WP_001547765.1 protein YkfB -
N0470_RS17705 (3619893) 3619893..3620132 + 240 WP_000194654.1 DUF905 family protein -
N0470_RS17710 (3620230) 3620230..3620688 + 459 WP_000211838.1 antirestriction protein -
N0470_RS17715 (3620704) 3620704..3621180 + 477 WP_000811693.1 RadC family protein -
N0470_RS17720 (3621189) 3621189..3621410 + 222 WP_000691994.1 DUF987 domain-containing protein -
N0470_RS17725 (3621429) 3621429..3621746 + 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
N0470_RS17730 (3621767) 3621767..3622108 + 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
N0470_RS17740 (3622680) 3622680..3623933 - 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
N0470_RS17745 (3623945) 3623945..3625048 - 1104 WP_001285288.1 glutamate 5-kinase -
N0470_RS17750 (3625336) 3625336..3626391 + 1056 WP_000749863.1 phosphoporin PhoE -
N0470_RS17755 (3626430) 3626430..3626831 - 402 WP_000174689.1 sigma factor-binding protein Crl -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T257603 WP_000854672.1 NZ_CP104326:3621767-3622108 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT257603 WP_000070395.1 NZ_CP104326:3621429-3621746 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References