Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3621429..3622108 | Replicon | chromosome |
| Accession | NZ_CP104326 | ||
| Organism | Escherichia coli strain THB42-F1 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | N0470_RS17730 | Protein ID | WP_000854672.1 |
| Coordinates | 3621767..3622108 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | N0470_RS17725 | Protein ID | WP_000070395.1 |
| Coordinates | 3621429..3621746 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0470_RS17675 (3616476) | 3616476..3617339 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| N0470_RS17680 (3617431) | 3617431..3618252 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| N0470_RS17685 (3618469) | 3618469..3618660 | + | 192 | Protein_3457 | DeoR family transcriptional regulator | - |
| N0470_RS17690 (3618707) | 3618707..3618883 | + | 177 | WP_001285112.1 | hypothetical protein | - |
| N0470_RS17695 (3618883) | 3618883..3619326 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
| N0470_RS17700 (3619349) | 3619349..3619816 | + | 468 | WP_001547765.1 | protein YkfB | - |
| N0470_RS17705 (3619893) | 3619893..3620132 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| N0470_RS17710 (3620230) | 3620230..3620688 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| N0470_RS17715 (3620704) | 3620704..3621180 | + | 477 | WP_000811693.1 | RadC family protein | - |
| N0470_RS17720 (3621189) | 3621189..3621410 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| N0470_RS17725 (3621429) | 3621429..3621746 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| N0470_RS17730 (3621767) | 3621767..3622108 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| N0470_RS17740 (3622680) | 3622680..3623933 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| N0470_RS17745 (3623945) | 3623945..3625048 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| N0470_RS17750 (3625336) | 3625336..3626391 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| N0470_RS17755 (3626430) | 3626430..3626831 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T257603 WP_000854672.1 NZ_CP104326:3621767-3622108 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|