Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2375646..2376284 | Replicon | chromosome |
| Accession | NZ_CP104326 | ||
| Organism | Escherichia coli strain THB42-F1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | N0470_RS11525 | Protein ID | WP_000813794.1 |
| Coordinates | 2376108..2376284 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N0470_RS11520 | Protein ID | WP_001270286.1 |
| Coordinates | 2375646..2376062 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0470_RS11500 (2370798) | 2370798..2371739 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| N0470_RS11505 (2371740) | 2371740..2372753 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| N0470_RS11510 (2372771) | 2372771..2373916 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| N0470_RS11515 (2374161) | 2374161..2375567 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| N0470_RS11520 (2375646) | 2375646..2376062 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N0470_RS11525 (2376108) | 2376108..2376284 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N0470_RS11530 (2376506) | 2376506..2376736 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| N0470_RS11535 (2376828) | 2376828..2378789 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N0470_RS11540 (2378862) | 2378862..2379398 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| N0470_RS11545 (2379451) | 2379451..2380665 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257601 WP_000813794.1 NZ_CP104326:c2376284-2376108 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257601 WP_001270286.1 NZ_CP104326:c2376062-2375646 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|