Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 973751..974334 | Replicon | chromosome |
Accession | NZ_CP104326 | ||
Organism | Escherichia coli strain THB42-F1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N0470_RS04665 | Protein ID | WP_000254738.1 |
Coordinates | 973999..974334 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N0470_RS04660 | Protein ID | WP_000581937.1 |
Coordinates | 973751..973999 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0470_RS04650 (970090) | 970090..971391 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N0470_RS04655 (971439) | 971439..973673 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N0470_RS04660 (973751) | 973751..973999 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N0470_RS04665 (973999) | 973999..974334 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N0470_RS04670 (974405) | 974405..975196 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N0470_RS04675 (975424) | 975424..977061 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N0470_RS04680 (977149) | 977149..978447 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T257590 WP_000254738.1 NZ_CP104326:973999-974334 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|