Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 292143..292803 | Replicon | chromosome |
| Accession | NZ_CP104323 | ||
| Organism | Stenotrophomonas maltophilia strain ACYCc.3B | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | K7564_RS01345 | Protein ID | WP_227863872.1 |
| Coordinates | 292143..292442 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | K7564_RS01350 | Protein ID | WP_005420598.1 |
| Coordinates | 292501..292803 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K7564_RS01320 (K7564_01320) | 287859..288140 | + | 282 | WP_227863867.1 | hypothetical protein | - |
| K7564_RS01325 (K7564_01325) | 288238..288738 | - | 501 | WP_227863868.1 | hypothetical protein | - |
| K7564_RS01330 (K7564_01330) | 288735..289802 | - | 1068 | WP_227863869.1 | AAA family ATPase | - |
| K7564_RS01335 (K7564_01335) | 289925..290440 | + | 516 | WP_227863870.1 | hypothetical protein | - |
| K7564_RS01340 (K7564_01340) | 290532..291719 | - | 1188 | WP_227863871.1 | integrase arm-type DNA-binding domain-containing protein | - |
| K7564_RS01345 (K7564_01345) | 292143..292442 | + | 300 | WP_227863872.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| K7564_RS01350 (K7564_01350) | 292501..292803 | + | 303 | WP_005420598.1 | putative addiction module antidote protein | Antitoxin |
| K7564_RS01355 (K7564_01355) | 292976..293377 | - | 402 | WP_126411622.1 | hypothetical protein | - |
| K7564_RS01360 (K7564_01360) | 293985..294755 | + | 771 | WP_227863873.1 | DUF3011 domain-containing protein | - |
| K7564_RS01365 (K7564_01365) | 294827..295276 | - | 450 | WP_227863874.1 | hypothetical protein | - |
| K7564_RS01370 (K7564_01370) | 295552..296472 | + | 921 | WP_227863875.1 | arginase | - |
| K7564_RS01375 (K7564_01375) | 296633..296770 | + | 138 | WP_014035659.1 | entericidin A/B family lipoprotein | - |
| K7564_RS01380 (K7564_01380) | 296974..297195 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 247622..295276 | 47654 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11202.96 Da Isoelectric Point: 10.6580
>T257583 WP_227863872.1 NZ_CP104323:292143-292442 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARILARIGRLAEGHPGDHRYLGDGISELRIDAGPGYRLYYTQCGRQLLILLVGG
DKSSQQRDIEKAREIARAL
MKIQRTRQFATWIDALKDVTARARILARILARIGRLAEGHPGDHRYLGDGISELRIDAGPGYRLYYTQCGRQLLILLVGG
DKSSQQRDIEKAREIARAL
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|