Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 6165881..6166445 | Replicon | chromosome |
Accession | NZ_CP104317 | ||
Organism | Streptomyces angustmyceticus strain CQUSa03 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW605_RS26890 | Protein ID | WP_260638778.1 |
Coordinates | 6165881..6166228 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NW605_RS26895 | Protein ID | WP_260638779.1 |
Coordinates | 6166215..6166445 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW605_RS26875 | 6161539..6162561 | + | 1023 | WP_086717413.1 | hypothetical protein | - |
NW605_RS26880 | 6162579..6164324 | - | 1746 | WP_260638776.1 | TIGR03767 family metallophosphoesterase | - |
NW605_RS26885 | 6164750..6165781 | + | 1032 | WP_260638777.1 | aspartate-semialdehyde dehydrogenase | - |
NW605_RS26890 | 6165881..6166228 | - | 348 | WP_260638778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW605_RS26895 | 6166215..6166445 | - | 231 | WP_260638779.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NW605_RS26900 | 6166571..6169165 | + | 2595 | WP_260638780.1 | aminopeptidase N | - |
NW605_RS26905 | 6169363..6170508 | - | 1146 | WP_260638781.1 | allantoicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12842.88 Da Isoelectric Point: 10.7646
>T257582 WP_260638778.1 NZ_CP104317:c6166228-6165881 [Streptomyces angustmyceticus]
MRRGDIYMVDLEPTRGSEANKIRPALIVSHNGANQSVEAHRRGVVTVVPLTSNTSRVLSFQVLLEAEECRLPKDSKAQCE
QLRAVAPERVLHKVGVVPRRRMAEVDAALRRHLAL
MRRGDIYMVDLEPTRGSEANKIRPALIVSHNGANQSVEAHRRGVVTVVPLTSNTSRVLSFQVLLEAEECRLPKDSKAQCE
QLRAVAPERVLHKVGVVPRRRMAEVDAALRRHLAL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|