Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 98256..98926 Replicon plasmid pKP81324
Accession NZ_CP104316
Organism Klebsiella pneumoniae strain KP8132

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag N2X67_RS28560 Protein ID WP_004213072.1
Coordinates 98483..98926 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag N2X67_RS28555 Protein ID WP_004213073.1
Coordinates 98256..98486 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2X67_RS28525 (N2X67_28525) 93774..94430 + 657 WP_231798523.1 hypothetical protein -
N2X67_RS28530 (N2X67_28530) 94479..95378 - 900 WP_004225022.1 nucleotide-binding protein -
N2X67_RS28535 (N2X67_28535) 95368..95658 - 291 WP_004213078.1 hypothetical protein -
N2X67_RS28540 (N2X67_28540) 96010..96216 + 207 WP_004213077.1 hypothetical protein -
N2X67_RS28545 (N2X67_28545) 96206..96499 - 294 WP_004213076.1 hypothetical protein -
N2X67_RS28550 (N2X67_28550) 96515..97648 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
N2X67_RS28555 (N2X67_28555) 98256..98486 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N2X67_RS28560 (N2X67_28560) 98483..98926 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
N2X67_RS28565 (N2X67_28565) 99075..99326 + 252 WP_186987481.1 hypothetical protein -
N2X67_RS28570 (N2X67_28570) 99349..99653 - 305 Protein_112 transposase -
N2X67_RS28575 (N2X67_28575) 100070..100704 + 635 Protein_113 mucoid phenotype regulator RmpA2 -
N2X67_RS28580 (N2X67_28580) 101222..101625 - 404 Protein_114 GAF domain-containing protein -
N2X67_RS28585 (N2X67_28585) 101716..102636 - 921 WP_004213934.1 DUF1471 domain-containing protein -
N2X67_RS28590 (N2X67_28590) 102685..103176 - 492 WP_011251327.1 DM13 domain-containing protein -
N2X67_RS28595 (N2X67_28595) 103239..103514 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iutA / iutA / iucD / iucC / iucB / iucA / iroN 1..194876 194876


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T257579 WP_004213072.1 NZ_CP104316:98483-98926 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT257579 WP_004213073.1 NZ_CP104316:98256-98486 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References