Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 98256..98926 | Replicon | plasmid pKP81324 |
| Accession | NZ_CP104316 | ||
| Organism | Klebsiella pneumoniae strain KP8132 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | N2X67_RS28560 | Protein ID | WP_004213072.1 |
| Coordinates | 98483..98926 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | N2X67_RS28555 | Protein ID | WP_004213073.1 |
| Coordinates | 98256..98486 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2X67_RS28525 (N2X67_28525) | 93774..94430 | + | 657 | WP_231798523.1 | hypothetical protein | - |
| N2X67_RS28530 (N2X67_28530) | 94479..95378 | - | 900 | WP_004225022.1 | nucleotide-binding protein | - |
| N2X67_RS28535 (N2X67_28535) | 95368..95658 | - | 291 | WP_004213078.1 | hypothetical protein | - |
| N2X67_RS28540 (N2X67_28540) | 96010..96216 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| N2X67_RS28545 (N2X67_28545) | 96206..96499 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| N2X67_RS28550 (N2X67_28550) | 96515..97648 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| N2X67_RS28555 (N2X67_28555) | 98256..98486 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N2X67_RS28560 (N2X67_28560) | 98483..98926 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N2X67_RS28565 (N2X67_28565) | 99075..99326 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| N2X67_RS28570 (N2X67_28570) | 99349..99653 | - | 305 | Protein_112 | transposase | - |
| N2X67_RS28575 (N2X67_28575) | 100070..100704 | + | 635 | Protein_113 | mucoid phenotype regulator RmpA2 | - |
| N2X67_RS28580 (N2X67_28580) | 101222..101625 | - | 404 | Protein_114 | GAF domain-containing protein | - |
| N2X67_RS28585 (N2X67_28585) | 101716..102636 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| N2X67_RS28590 (N2X67_28590) | 102685..103176 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| N2X67_RS28595 (N2X67_28595) | 103239..103514 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iutA / iutA / iucD / iucC / iucB / iucA / iroN | 1..194876 | 194876 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T257579 WP_004213072.1 NZ_CP104316:98483-98926 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|