Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 2372..3015 | Replicon | plasmid pKP81324 |
Accession | NZ_CP104316 | ||
Organism | Klebsiella pneumoniae strain KP8132 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | N2X67_RS28020 | Protein ID | WP_001044770.1 |
Coordinates | 2372..2788 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | N2X67_RS28025 | Protein ID | WP_001261282.1 |
Coordinates | 2785..3015 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2X67_RS28015 (N2X67_28015) | 742..2299 | - | 1558 | Protein_1 | AAA family ATPase | - |
N2X67_RS28020 (N2X67_28020) | 2372..2788 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N2X67_RS28025 (N2X67_28025) | 2785..3015 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N2X67_RS28030 (N2X67_28030) | 2972..3388 | + | 417 | WP_164481821.1 | hypothetical protein | - |
N2X67_RS28035 (N2X67_28035) | 3933..4754 | + | 822 | WP_004213562.1 | hypothetical protein | - |
N2X67_RS28040 (N2X67_28040) | 4751..5530 | + | 780 | WP_004213560.1 | site-specific integrase | - |
N2X67_RS28045 (N2X67_28045) | 5675..6604 | - | 930 | WP_004213558.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
N2X67_RS28050 (N2X67_28050) | 6908..7075 | + | 168 | Protein_8 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | rmpA / iutA / iutA / iucD / iucC / iucB / iucA / iroN | 1..194876 | 194876 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T257578 WP_001044770.1 NZ_CP104316:c2788-2372 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |