Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 3372..3952 | Replicon | plasmid pKP81321 |
Accession | NZ_CP104313 | ||
Organism | Klebsiella pneumoniae strain KP8132 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | N2X67_RS26615 | Protein ID | WP_071177730.1 |
Coordinates | 3372..3686 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | N2X67_RS26620 | Protein ID | WP_000093040.1 |
Coordinates | 3674..3952 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2X67_RS26595 (N2X67_26595) | 1280..2011 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
N2X67_RS26600 (N2X67_26600) | 2018..2548 | + | 531 | WP_071177729.1 | hypothetical protein | - |
N2X67_RS26605 (N2X67_26605) | 2575..2754 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
N2X67_RS26610 (N2X67_26610) | 2780..3208 | - | 429 | WP_001140599.1 | hypothetical protein | - |
N2X67_RS26615 (N2X67_26615) | 3372..3686 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N2X67_RS26620 (N2X67_26620) | 3674..3952 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
N2X67_RS26625 (N2X67_26625) | 4127..4492 | - | 366 | WP_072354022.1 | TonB family protein | - |
N2X67_RS26630 (N2X67_26630) | 4489..4860 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
N2X67_RS26635 (N2X67_26635) | 5134..5379 | - | 246 | WP_032440458.1 | hypothetical protein | - |
N2X67_RS26640 (N2X67_26640) | 6024..7511 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
N2X67_RS26645 (N2X67_26645) | 7616..8359 | + | 744 | Protein_11 | cloacin | - |
N2X67_RS26650 (N2X67_26650) | 8455..8532 | + | 78 | WP_260714748.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..12047 | 12047 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T257571 WP_071177730.1 NZ_CP104313:c3686-3372 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|