Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4842853..4843369 | Replicon | chromosome |
| Accession | NZ_CP104312 | ||
| Organism | Klebsiella pneumoniae strain KP8132 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | N2X67_RS23895 | Protein ID | WP_002886902.1 |
| Coordinates | 4842853..4843137 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | N2X67_RS23900 | Protein ID | WP_002886901.1 |
| Coordinates | 4843127..4843369 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2X67_RS23870 (N2X67_23870) | 4838337..4838600 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| N2X67_RS23875 (N2X67_23875) | 4838730..4838903 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| N2X67_RS23880 (N2X67_23880) | 4838906..4839649 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| N2X67_RS23885 (N2X67_23885) | 4840006..4842144 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| N2X67_RS23890 (N2X67_23890) | 4842385..4842849 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| N2X67_RS23895 (N2X67_23895) | 4842853..4843137 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2X67_RS23900 (N2X67_23900) | 4843127..4843369 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N2X67_RS23905 (N2X67_23905) | 4843447..4845357 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| N2X67_RS23910 (N2X67_23910) | 4845380..4846534 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| N2X67_RS23915 (N2X67_23915) | 4846600..4847340 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T257568 WP_002886902.1 NZ_CP104312:c4843137-4842853 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |