Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 77270..77795 | Replicon | plasmid p380-94 |
| Accession | NZ_CP104310 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | NUE46_RS27470 | Protein ID | WP_001159868.1 |
| Coordinates | 77490..77795 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NUE46_RS27465 | Protein ID | WP_000813634.1 |
| Coordinates | 77270..77488 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS27435 (72553) | 72553..72783 | + | 231 | WP_010891288.1 | hypothetical protein | - |
| NUE46_RS27440 (72904) | 72904..73644 | + | 741 | WP_001066920.1 | tyrosine-type recombinase/integrase | - |
| NUE46_RS27445 (73929) | 73929..74906 | - | 978 | WP_000361615.1 | RepB family plasmid replication initiator protein | - |
| NUE46_RS27450 (75314) | 75314..75514 | - | 201 | WP_000708307.1 | hypothetical protein | - |
| NUE46_RS27455 (75511) | 75511..76131 | - | 621 | WP_001248529.1 | hypothetical protein | - |
| NUE46_RS27460 (76128) | 76128..76811 | - | 684 | WP_010891291.1 | DNA-binding protein | - |
| NUE46_RS27465 (77270) | 77270..77488 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NUE46_RS27470 (77490) | 77490..77795 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NUE46_RS27475 (77796) | 77796..78602 | + | 807 | WP_000016989.1 | site-specific integrase | - |
| NUE46_RS27485 (80500) | 80500..80838 | + | 339 | WP_071525396.1 | RepB family plasmid replication initiator protein | - |
| NUE46_RS27490 (81426) | 81426..82592 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | toxB / espP / stcE / exeE / exeG / hlyC / hlyA / hlyB / hlyD | 1..92704 | 92704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T257555 WP_001159868.1 NZ_CP104310:77490-77795 [Escherichia coli O157:H7]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|