Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 30198..30757 Replicon plasmid p380-94
Accession NZ_CP104310
Organism Escherichia coli O157:H7 strain 380-94

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag NUE46_RS27245 Protein ID WP_000421248.1
Coordinates 30482..30757 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag NUE46_RS27240 Protein ID WP_001178089.1
Coordinates 30198..30482 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUE46_RS27200 (25390) 25390..25950 + 561 WP_000840472.1 fertility inhibition protein FinO -
NUE46_RS27205 (26083) 26083..26295 + 213 WP_001302189.1 ANR family transcriptional regulator -
NUE46_RS27210 (26540) 26540..27001 + 462 WP_001233853.1 thermonuclease family protein -
NUE46_RS27215 (27047) 27047..27256 + 210 WP_001302200.1 hemolysin expression modulator Hha -
NUE46_RS27220 (27294) 27294..27632 + 339 WP_000766796.1 hypothetical protein -
NUE46_RS27225 (27872) 27872..28126 + 255 WP_000083831.1 replication regulatory protein RepA -
NUE46_RS27230 (28362) 28362..28436 + 75 WP_001370046.1 RepA leader peptide Tap -
NUE46_RS27235 (28429) 28429..29286 + 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
NUE46_RS27240 (30198) 30198..30482 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
NUE46_RS27245 (30482) 30482..30757 + 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NUE46_RS27250 (30852) 30852..31058 + 207 WP_001105064.1 hypothetical protein -
NUE46_RS27255 (31158) 31158..31373 - 216 Protein_36 transposase -
NUE46_RS27260 (31417) 31417..31983 - 567 Protein_37 IS3-like element IS600 family transposase -
NUE46_RS27265 (31983) 31983..32399 - 417 Protein_38 IS91 family transposase -
NUE46_RS27270 (32399) 32399..32584 - 186 WP_001302179.1 hypothetical protein -
NUE46_RS27275 (32761) 32761..34971 + 2211 WP_000592771.1 catalase/peroxidase KatP -
NUE46_RS27280 (35015) 35015..35404 + 390 WP_001172748.1 cytochrome b562 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - toxB / espP / stcE / exeE / exeG / hlyC / hlyA / hlyB / hlyD 1..92704 92704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T257554 WP_000421248.1 NZ_CP104310:30482-30757 [Escherichia coli O157:H7]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT257554 WP_001178089.1 NZ_CP104310:30198-30482 [Escherichia coli O157:H7]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References