Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4597338..4597888 Replicon chromosome
Accession NZ_CP104309
Organism Escherichia coli O157:H7 strain 380-94

Toxin (Protein)


Gene name ccdB Uniprot ID D3H432
Locus tag NUE46_RS23240 Protein ID WP_001160975.1
Coordinates 4597338..4597652 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NUE46_RS23245 Protein ID WP_000125566.1
Coordinates 4597655..4597888 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUE46_RS23215 (4593013) 4593013..4594299 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
NUE46_RS23220 (4594299) 4594299..4595288 + 990 WP_000241259.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NUE46_RS23225 (4595285) 4595285..4596106 + 822 WP_001065380.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NUE46_RS23230 (4596109) 4596109..4596486 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NUE46_RS23235 (4596493) 4596493..4597341 + 849 WP_000257187.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NUE46_RS23240 (4597338) 4597338..4597652 - 315 WP_001160975.1 CcdB family protein Toxin
NUE46_RS23245 (4597655) 4597655..4597888 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NUE46_RS23250 (4597974) 4597974..4598453 - 480 WP_000624372.1 type 3 dihydrofolate reductase -
NUE46_RS23255 (4598645) 4598645..4600507 - 1863 WP_000377184.1 glutathione-regulated potassium-efflux system protein KefC -
NUE46_RS23260 (4600500) 4600500..4601030 - 531 WP_000600700.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NUE46_RS23265 (4601138) 4601138..4602469 - 1332 WP_001183177.1 MFS transporter -
NUE46_RS23270 (4602527) 4602527..4602814 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.76 Da        Isoelectric Point: 9.8517

>T257549 WP_001160975.1 NZ_CP104309:c4597652-4597338 [Escherichia coli O157:H7]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT257549 WP_000125566.1 NZ_CP104309:c4597888-4597655 [Escherichia coli O157:H7]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References