Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4105909..4106527 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NUE46_RS20940 | Protein ID | WP_001291435.1 |
| Coordinates | 4106309..4106527 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NUE46_RS20935 | Protein ID | WP_000344800.1 |
| Coordinates | 4105909..4106283 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS20925 (4100998) | 4100998..4102191 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NUE46_RS20930 (4102214) | 4102214..4105363 | + | 3150 | WP_001132452.1 | efflux RND transporter permease AcrB | - |
| NUE46_RS20935 (4105909) | 4105909..4106283 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NUE46_RS20940 (4106309) | 4106309..4106527 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NUE46_RS20945 (4106699) | 4106699..4107250 | + | 552 | WP_000102553.1 | maltose O-acetyltransferase | - |
| NUE46_RS20950 (4107366) | 4107366..4107836 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NUE46_RS20955 (4108000) | 4108000..4109550 | + | 1551 | WP_001301851.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NUE46_RS20960 (4109592) | 4109592..4109945 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NUE46_RS20970 (4110324) | 4110324..4110635 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NUE46_RS20975 (4110668) | 4110668..4111240 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T257547 WP_001291435.1 NZ_CP104309:4106309-4106527 [Escherichia coli O157:H7]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT257547 WP_000344800.1 NZ_CP104309:4105909-4106283 [Escherichia coli O157:H7]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |