Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3612325..3613030 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q8X3N0 |
| Locus tag | NUE46_RS18545 | Protein ID | WP_000539519.1 |
| Coordinates | 3612325..3612711 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NUE46_RS18550 | Protein ID | WP_001280945.1 |
| Coordinates | 3612701..3613030 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS18525 (3608329) | 3608329..3608955 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| NUE46_RS18530 (3608952) | 3608952..3610067 | - | 1116 | WP_000554959.1 | aldose sugar dehydrogenase YliI | - |
| NUE46_RS18535 (3610178) | 3610178..3610561 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| NUE46_RS18540 (3610774) | 3610774..3612099 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| NUE46_RS18545 (3612325) | 3612325..3612711 | + | 387 | WP_000539519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUE46_RS18550 (3612701) | 3612701..3613030 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| NUE46_RS18555 (3613100) | 3613100..3614428 | - | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
| NUE46_RS18560 (3614436) | 3614436..3616784 | - | 2349 | WP_000950320.1 | EAL domain-containing protein | - |
| NUE46_RS18565 (3616962) | 3616962..3617873 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14279.42 Da Isoelectric Point: 9.9296
>T257546 WP_000539519.1 NZ_CP104309:3612325-3612711 [Escherichia coli O157:H7]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|