Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 3446164..3446642 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A891SFN9 |
| Locus tag | NUE46_RS17790 | Protein ID | WP_001303876.1 |
| Coordinates | 3446355..3446642 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | Q8XD67 |
| Locus tag | NUE46_RS17785 | Protein ID | WP_000536233.1 |
| Coordinates | 3446164..3446355 (+) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS17750 (3441568) | 3441568..3442338 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| NUE46_RS17755 (3442360) | 3442360..3443106 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
| NUE46_RS17760 (3443113) | 3443113..3444204 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
| NUE46_RS17765 (3444283) | 3444283..3444738 | + | 456 | WP_000273724.1 | hypothetical protein | - |
| NUE46_RS17770 (3444945) | 3444945..3445370 | - | 426 | WP_000693855.1 | toxin YdaT family protein | - |
| NUE46_RS17775 (3445354) | 3445354..3445626 | - | 273 | WP_000887453.1 | YdaS family helix-turn-helix protein | - |
| NUE46_RS17780 (3445735) | 3445735..3446136 | + | 402 | WP_000986592.1 | helix-turn-helix domain-containing protein | - |
| NUE46_RS17785 (3446164) | 3446164..3446355 | + | 192 | WP_000536233.1 | hypothetical protein | Antitoxin |
| NUE46_RS17790 (3446355) | 3446355..3446642 | + | 288 | WP_001303876.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUE46_RS17795 (3446920) | 3446920..3447075 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| NUE46_RS17800 (3447077) | 3447077..3447205 | + | 129 | WP_000344963.1 | protein YdfB | - |
| NUE46_RS17805 (3447217) | 3447217..3447606 | + | 390 | WP_000394511.1 | hypothetical protein | - |
| NUE46_RS17810 (3447793) | 3447793..3447978 | - | 186 | WP_001133046.1 | hypothetical protein | - |
| NUE46_RS17815 (3448552) | 3448552..3448740 | + | 189 | WP_000413705.1 | cell division inhibition protein DicB | - |
| NUE46_RS17820 (3448737) | 3448737..3448928 | + | 192 | WP_001098307.1 | DUF1482 family protein | - |
| NUE46_RS17825 (3449022) | 3449022..3451493 | + | 2472 | WP_000034474.1 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10978.84 Da Isoelectric Point: 10.1360
>T257545 WP_001303876.1 NZ_CP104309:3446355-3446642 [Escherichia coli O157:H7]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|