Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3446164..3446642 Replicon chromosome
Accession NZ_CP104309
Organism Escherichia coli O157:H7 strain 380-94

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag NUE46_RS17790 Protein ID WP_001303876.1
Coordinates 3446355..3446642 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag NUE46_RS17785 Protein ID WP_000536233.1
Coordinates 3446164..3446355 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUE46_RS17750 (3441568) 3441568..3442338 - 771 WP_000450992.1 DUF1627 domain-containing protein -
NUE46_RS17755 (3442360) 3442360..3443106 - 747 WP_000788751.1 ATP-binding protein -
NUE46_RS17760 (3443113) 3443113..3444204 - 1092 WP_001205823.1 hypothetical protein -
NUE46_RS17765 (3444283) 3444283..3444738 + 456 WP_000273724.1 hypothetical protein -
NUE46_RS17770 (3444945) 3444945..3445370 - 426 WP_000693855.1 toxin YdaT family protein -
NUE46_RS17775 (3445354) 3445354..3445626 - 273 WP_000887453.1 YdaS family helix-turn-helix protein -
NUE46_RS17780 (3445735) 3445735..3446136 + 402 WP_000986592.1 helix-turn-helix domain-containing protein -
NUE46_RS17785 (3446164) 3446164..3446355 + 192 WP_000536233.1 hypothetical protein Antitoxin
NUE46_RS17790 (3446355) 3446355..3446642 + 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NUE46_RS17795 (3446920) 3446920..3447075 + 156 WP_000379575.1 DUF1391 family protein -
NUE46_RS17800 (3447077) 3447077..3447205 + 129 WP_000344963.1 protein YdfB -
NUE46_RS17805 (3447217) 3447217..3447606 + 390 WP_000394511.1 hypothetical protein -
NUE46_RS17810 (3447793) 3447793..3447978 - 186 WP_001133046.1 hypothetical protein -
NUE46_RS17815 (3448552) 3448552..3448740 + 189 WP_000413705.1 cell division inhibition protein DicB -
NUE46_RS17820 (3448737) 3448737..3448928 + 192 WP_001098307.1 DUF1482 family protein -
NUE46_RS17825 (3449022) 3449022..3451493 + 2472 WP_000034474.1 exonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T257545 WP_001303876.1 NZ_CP104309:3446355-3446642 [Escherichia coli O157:H7]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT257545 WP_000536233.1 NZ_CP104309:3446164-3446355 [Escherichia coli O157:H7]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References