Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2676520..2677158 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NUE46_RS13485 | Protein ID | WP_000813794.1 |
| Coordinates | 2676520..2676696 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NUE46_RS13490 | Protein ID | WP_001270286.1 |
| Coordinates | 2676742..2677158 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS13465 (2672142) | 2672142..2673314 | - | 1173 | WP_001236316.1 | BenE family transporter YdcO | - |
| NUE46_RS13470 (2673406) | 2673406..2673942 | + | 537 | WP_000429145.1 | DNA-binding transcriptional regulator SutR | - |
| NUE46_RS13475 (2674015) | 2674015..2675976 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NUE46_RS13480 (2676068) | 2676068..2676298 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| NUE46_RS13485 (2676520) | 2676520..2676696 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NUE46_RS13490 (2676742) | 2676742..2677158 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NUE46_RS13495 (2677237) | 2677237..2678643 | + | 1407 | WP_000760654.1 | PLP-dependent aminotransferase family protein | - |
| NUE46_RS13500 (2678888) | 2678888..2680033 | + | 1146 | WP_000047432.1 | ABC transporter substrate-binding protein | - |
| NUE46_RS13505 (2680051) | 2680051..2681064 | + | 1014 | WP_000220402.1 | ABC transporter ATP-binding protein | - |
| NUE46_RS13510 (2681065) | 2681065..2682006 | + | 942 | WP_001251320.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257543 WP_000813794.1 NZ_CP104309:2676520-2676696 [Escherichia coli O157:H7]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257543 WP_001270286.1 NZ_CP104309:2676742-2677158 [Escherichia coli O157:H7]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|