Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 890207..890861 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NUE46_RS04440 | Protein ID | WP_000244781.1 |
| Coordinates | 890454..890861 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NUE46_RS04435 | Protein ID | WP_000354046.1 |
| Coordinates | 890207..890473 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS04415 (886472) | 886472..887728 | - | 1257 | WP_009671380.1 | family 1 glycosylhydrolase | - |
| NUE46_RS04420 (887773) | 887773..888084 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| NUE46_RS04425 (888248) | 888248..888907 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NUE46_RS04430 (888984) | 888984..889964 | - | 981 | WP_000886053.1 | tRNA-modifying protein YgfZ | - |
| NUE46_RS04435 (890207) | 890207..890473 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NUE46_RS04440 (890454) | 890454..890861 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NUE46_RS04445 (890901) | 890901..891422 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NUE46_RS04450 (891534) | 891534..892430 | + | 897 | WP_000806640.1 | site-specific tyrosine recombinase XerD | - |
| NUE46_RS04455 (892455) | 892455..893165 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NUE46_RS04460 (893171) | 893171..894904 | + | 1734 | WP_000813185.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T257533 WP_000244781.1 NZ_CP104309:890454-890861 [Escherichia coli O157:H7]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|