Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 400883..401637 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | NUE46_RS01915 | Protein ID | WP_001301452.1 |
| Coordinates | 400883..401368 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | Q8X700 |
| Locus tag | NUE46_RS01920 | Protein ID | WP_000801912.1 |
| Coordinates | 401359..401637 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS01895 (396049) | 396049..396807 | + | 759 | WP_001302007.1 | DeoR/GlpR family transcriptional regulator | - |
| NUE46_RS01900 (396789) | 396789..398387 | - | 1599 | WP_001232889.1 | DNA-binding transcriptional regulator RtcR | - |
| NUE46_RS01905 (398575) | 398575..399801 | + | 1227 | WP_001105473.1 | RNA-splicing ligase RtcB | - |
| NUE46_RS01910 (399805) | 399805..400833 | + | 1029 | WP_000827117.1 | RNA 3'-terminal phosphate cyclase | - |
| NUE46_RS01915 (400883) | 400883..401368 | - | 486 | WP_001301452.1 | GNAT family N-acetyltransferase | Toxin |
| NUE46_RS01920 (401359) | 401359..401637 | - | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
| NUE46_RS01925 (401704) | 401704..404409 | - | 2706 | WP_000906970.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17650.57 Da Isoelectric Point: 9.4066
>T257530 WP_001301452.1 NZ_CP104309:c401368-400883 [Escherichia coli O157:H7]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|