Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 351953..352753 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A891SNC1 |
| Locus tag | NUE46_RS01705 | Protein ID | WP_000342448.1 |
| Coordinates | 352226..352753 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | NUE46_RS01700 | Protein ID | WP_001277108.1 |
| Coordinates | 351953..352219 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS01680 (347611) | 347611..348279 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| NUE46_RS01685 (348272) | 348272..349330 | + | 1059 | WP_001042018.1 | permease-like cell division protein FtsX | - |
| NUE46_RS01690 (349575) | 349575..350429 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NUE46_RS01695 (350700) | 350700..351803 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NUE46_RS01700 (351953) | 351953..352219 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NUE46_RS01705 (352226) | 352226..352753 | + | 528 | WP_000342448.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NUE46_RS01710 (352750) | 352750..353133 | - | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NUE46_RS01715 (353557) | 353557..354666 | + | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NUE46_RS01720 (354714) | 354714..355640 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NUE46_RS01725 (355637) | 355637..356914 | + | 1278 | WP_000803797.1 | branched chain amino acid ABC transporter permease LivM | - |
| NUE46_RS01730 (356911) | 356911..357678 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19692.68 Da Isoelectric Point: 7.3232
>T257529 WP_000342448.1 NZ_CP104309:352226-352753 [Escherichia coli O157:H7]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|