Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 309522..310153 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q8X5S6 |
| Locus tag | NUE46_RS01455 | Protein ID | WP_001259386.1 |
| Coordinates | 309522..309797 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | U9Y7E1 |
| Locus tag | NUE46_RS01460 | Protein ID | WP_000593555.1 |
| Coordinates | 309794..310153 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS01440 (304526) | 304526..305593 | + | 1068 | WP_000361458.1 | HlyD family secretion protein | - |
| NUE46_RS01445 (305590) | 305590..308325 | + | 2736 | WP_000149107.1 | ribosome-associated ATPase/putative transporter RbbA | - |
| NUE46_RS01450 (308325) | 308325..309449 | + | 1125 | WP_001301659.1 | ABC transporter permease | - |
| NUE46_RS01455 (309522) | 309522..309797 | + | 276 | WP_001259386.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NUE46_RS01460 (309794) | 309794..310153 | + | 360 | WP_000593555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NUE46_RS01465 (310203) | 310203..311063 | - | 861 | WP_001131788.1 | class II aldolase | - |
| NUE46_RS01470 (311095) | 311095..311364 | - | 270 | WP_000933060.1 | HPr family phosphocarrier protein | - |
| NUE46_RS01475 (311354) | 311354..312862 | - | 1509 | WP_001301773.1 | FGGY-family carbohydrate kinase | - |
| NUE46_RS01480 (312855) | 312855..314213 | - | 1359 | WP_001302220.1 | PTS galactitol transporter subunit IIC | - |
| NUE46_RS01485 (314290) | 314290..314571 | - | 282 | WP_000084025.1 | PTS sugar transporter subunit IIB | - |
| NUE46_RS01490 (314568) | 314568..315041 | - | 474 | WP_001161553.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 300666..310153 | 9487 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10165.92 Da Isoelectric Point: 10.7076
>T257528 WP_001259386.1 NZ_CP104309:309522-309797 [Escherichia coli O157:H7]
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKEGRGSRCKLILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKEGRGSRCKLILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13402.27 Da Isoelectric Point: 5.1987
>AT257528 WP_000593555.1 NZ_CP104309:309794-310153 [Escherichia coli O157:H7]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1I9WXY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LKZ6 |