Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA(toxin) |
Location | 421476..422070 | Replicon | chromosome |
Accession | NZ_CP104307 | ||
Organism | Flavobacterium sp. TR2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N4T20_RS02055 | Protein ID | WP_260671472.1 |
Coordinates | 421828..422070 (-) | Length | 81 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4T20_RS02050 | Protein ID | WP_260671471.1 |
Coordinates | 421476..421826 (-) | Length | 117 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T20_RS02025 (N4T20_02025) | 417427..417912 | + | 486 | WP_073418297.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
N4T20_RS02030 (N4T20_02030) | 418073..418300 | + | 228 | WP_260671467.1 | hypothetical protein | - |
N4T20_RS02035 (N4T20_02035) | 418300..418587 | + | 288 | WP_260671468.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N4T20_RS02040 (N4T20_02040) | 418624..420651 | + | 2028 | WP_260671469.1 | M3 family metallopeptidase | - |
N4T20_RS02045 (N4T20_02045) | 420783..421442 | + | 660 | WP_260671470.1 | ElyC/SanA/YdcF family protein | - |
N4T20_RS02050 (N4T20_02050) | 421476..421826 | - | 351 | WP_260671471.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N4T20_RS02055 (N4T20_02055) | 421828..422070 | - | 243 | WP_260671472.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N4T20_RS02060 (N4T20_02060) | 422237..423499 | - | 1263 | WP_260671473.1 | sodium:proton antiporter | - |
N4T20_RS02065 (N4T20_02065) | 424077..424889 | - | 813 | WP_260671474.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 81 a.a. Molecular weight: 9458.05 Da Isoelectric Point: 9.9791
>T257527 WP_260671472.1 NZ_CP104307:c422070-421828 [Flavobacterium sp. TR2]
MSKIDKLIEKLKSKPKDFSWDEMVKVLKYFGYEQISQGKTGGSRRKFVNENKQIISLHEPHPQKVLKSYQLDIIIEHLEL
MSKIDKLIEKLKSKPKDFSWDEMVKVLKYFGYEQISQGKTGGSRRKFVNENKQIISLHEPHPQKVLKSYQLDIIIEHLEL
Download Length: 243 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 13201.99 Da Isoelectric Point: 4.7746
>AT257527 WP_260671471.1 NZ_CP104307:c421826-421476 [Flavobacterium sp. TR2]
MKNYLEYNGYIGTLEFSADDKIFFGKIQGINDLVTFEGSSVTELEESFKEAVDDYLETCKLLNKAPDKTYKGSFNVRVSQ
ELHQKISLLATKKGLNLNEIVKEALSYVVKHEEILN
MKNYLEYNGYIGTLEFSADDKIFFGKIQGINDLVTFEGSSVTELEESFKEAVDDYLETCKLLNKAPDKTYKGSFNVRVSQ
ELHQKISLLATKKGLNLNEIVKEALSYVVKHEEILN
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|