Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA(toxin) |
| Location | 421476..422070 | Replicon | chromosome |
| Accession | NZ_CP104307 | ||
| Organism | Flavobacterium sp. TR2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N4T20_RS02055 | Protein ID | WP_260671472.1 |
| Coordinates | 421828..422070 (-) | Length | 81 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N4T20_RS02050 | Protein ID | WP_260671471.1 |
| Coordinates | 421476..421826 (-) | Length | 117 a.a. |
Genomic Context
Location: 417427..417912 (486 bp)
Type: Others
Protein ID: WP_073418297.1
Type: Others
Protein ID: WP_073418297.1
Location: 418073..418300 (228 bp)
Type: Others
Protein ID: WP_260671467.1
Type: Others
Protein ID: WP_260671467.1
Location: 418300..418587 (288 bp)
Type: Others
Protein ID: WP_260671468.1
Type: Others
Protein ID: WP_260671468.1
Location: 418624..420651 (2028 bp)
Type: Others
Protein ID: WP_260671469.1
Type: Others
Protein ID: WP_260671469.1
Location: 420783..421442 (660 bp)
Type: Others
Protein ID: WP_260671470.1
Type: Others
Protein ID: WP_260671470.1
Location: 421476..421826 (351 bp)
Type: Antitoxin
Protein ID: WP_260671471.1
Type: Antitoxin
Protein ID: WP_260671471.1
Location: 421828..422070 (243 bp)
Type: Toxin
Protein ID: WP_260671472.1
Type: Toxin
Protein ID: WP_260671472.1
Location: 422237..423499 (1263 bp)
Type: Others
Protein ID: WP_260671473.1
Type: Others
Protein ID: WP_260671473.1
Location: 424077..424889 (813 bp)
Type: Others
Protein ID: WP_260671474.1
Type: Others
Protein ID: WP_260671474.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T20_RS02025 (N4T20_02025) | 417427..417912 | + | 486 | WP_073418297.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| N4T20_RS02030 (N4T20_02030) | 418073..418300 | + | 228 | WP_260671467.1 | hypothetical protein | - |
| N4T20_RS02035 (N4T20_02035) | 418300..418587 | + | 288 | WP_260671468.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N4T20_RS02040 (N4T20_02040) | 418624..420651 | + | 2028 | WP_260671469.1 | M3 family metallopeptidase | - |
| N4T20_RS02045 (N4T20_02045) | 420783..421442 | + | 660 | WP_260671470.1 | ElyC/SanA/YdcF family protein | - |
| N4T20_RS02050 (N4T20_02050) | 421476..421826 | - | 351 | WP_260671471.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4T20_RS02055 (N4T20_02055) | 421828..422070 | - | 243 | WP_260671472.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4T20_RS02060 (N4T20_02060) | 422237..423499 | - | 1263 | WP_260671473.1 | sodium:proton antiporter | - |
| N4T20_RS02065 (N4T20_02065) | 424077..424889 | - | 813 | WP_260671474.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 81 a.a. Molecular weight: 9458.05 Da Isoelectric Point: 9.9791
>T257527 WP_260671472.1 NZ_CP104307:c422070-421828 [Flavobacterium sp. TR2]
MSKIDKLIEKLKSKPKDFSWDEMVKVLKYFGYEQISQGKTGGSRRKFVNENKQIISLHEPHPQKVLKSYQLDIIIEHLEL
MSKIDKLIEKLKSKPKDFSWDEMVKVLKYFGYEQISQGKTGGSRRKFVNENKQIISLHEPHPQKVLKSYQLDIIIEHLEL
Download Length: 243 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 13201.99 Da Isoelectric Point: 4.7746
>AT257527 WP_260671471.1 NZ_CP104307:c421826-421476 [Flavobacterium sp. TR2]
MKNYLEYNGYIGTLEFSADDKIFFGKIQGINDLVTFEGSSVTELEESFKEAVDDYLETCKLLNKAPDKTYKGSFNVRVSQ
ELHQKISLLATKKGLNLNEIVKEALSYVVKHEEILN
MKNYLEYNGYIGTLEFSADDKIFFGKIQGINDLVTFEGSSVTELEESFKEAVDDYLETCKLLNKAPDKTYKGSFNVRVSQ
ELHQKISLLATKKGLNLNEIVKEALSYVVKHEEILN
Download Length: 351 bp