Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2768316..2768967 | Replicon | chromosome |
Accession | NZ_CP104303 | ||
Organism | Lacticaseibacillus paracasei strain VHProbi O44 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K6S8L5 |
Locus tag | N4T21_RS13605 | Protein ID | WP_003567661.1 |
Coordinates | 2768316..2768699 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | K6RKI5 |
Locus tag | N4T21_RS13610 | Protein ID | WP_003567665.1 |
Coordinates | 2768719..2768967 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T21_RS13600 (N4T21_13600) | 2767611..2768132 | - | 522 | WP_003567657.1 | QueT transporter family protein | - |
N4T21_RS13605 (N4T21_13605) | 2768316..2768699 | - | 384 | WP_003567661.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N4T21_RS13610 (N4T21_13610) | 2768719..2768967 | - | 249 | WP_003567665.1 | antitoxin | Antitoxin |
N4T21_RS13615 (N4T21_13615) | 2769035..2770171 | - | 1137 | WP_003581082.1 | alanine racemase | - |
N4T21_RS13620 (N4T21_13620) | 2770158..2770532 | - | 375 | WP_003567669.1 | holo-ACP synthase | - |
N4T21_RS13625 (N4T21_13625) | 2770701..2772209 | - | 1509 | WP_003567670.1 | DEAD/DEAH box helicase | - |
N4T21_RS13630 (N4T21_13630) | 2772335..2772478 | - | 144 | WP_016380391.1 | hypothetical protein | - |
N4T21_RS13635 (N4T21_13635) | 2772509..2773897 | - | 1389 | WP_003581096.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13773.03 Da Isoelectric Point: 10.9764
>T257526 WP_003567661.1 NZ_CP104303:c2768699-2768316 [Lacticaseibacillus paracasei]
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K6S8L5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2BNY2 |