Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 2371963..2372642 | Replicon | chromosome |
Accession | NZ_CP104302 | ||
Organism | Mycolicibacterium brumae strain ATCC 51384 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | L2Z93_RS11460 | Protein ID | WP_090584775.1 |
Coordinates | 2371963..2372367 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | L2Z93_RS11465 | Protein ID | WP_090584777.1 |
Coordinates | 2372364..2372642 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2Z93_RS11440 (L2Z93_002282) | 2367308..2368864 | + | 1557 | WP_090584769.1 | alpha/beta fold hydrolase | - |
L2Z93_RS11445 (L2Z93_002283) | 2368935..2370200 | + | 1266 | Protein_2243 | glycosyltransferase family 87 protein | - |
L2Z93_RS11450 (L2Z93_002284) | 2370506..2371327 | - | 822 | Protein_2244 | hypothetical protein | - |
L2Z93_RS11455 (L2Z93_002285) | 2371515..2371940 | + | 426 | WP_090584773.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
L2Z93_RS11460 (L2Z93_002286) | 2371963..2372367 | - | 405 | WP_090584775.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
L2Z93_RS11465 (L2Z93_002287) | 2372364..2372642 | - | 279 | WP_090584777.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
L2Z93_RS11470 (L2Z93_002288) | 2372680..2373432 | - | 753 | WP_090584779.1 | class I SAM-dependent methyltransferase | - |
L2Z93_RS11475 (L2Z93_002289) | 2373441..2374133 | - | 693 | WP_090584980.1 | chlorite dismutase family protein | - |
L2Z93_RS11480 (L2Z93_002290) | 2374158..2375501 | - | 1344 | WP_090584982.1 | protoporphyrinogen oxidase | - |
L2Z93_RS11485 (L2Z93_002291) | 2375555..2376616 | - | 1062 | WP_090584781.1 | uroporphyrinogen decarboxylase | - |
L2Z93_RS11490 (L2Z93_002292) | 2376724..2377305 | + | 582 | WP_090584783.1 | DUF3000 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14386.54 Da Isoelectric Point: 4.5502
>T257520 WP_090584775.1 NZ_CP104302:c2372367-2371963 [Mycolicibacterium brumae]
MIYLDTSALVKLLVTEDETPALRRWLSEQTSGGVFAATSTLGRIELMRAAARYSEPGLADRARFLLDGMDLLPLTESVLT
LAETIGPPSLRSLDAIHLAAAAHVRDELTAFVTYDRRLLDGCCDVGLAVVSPGA
MIYLDTSALVKLLVTEDETPALRRWLSEQTSGGVFAATSTLGRIELMRAAARYSEPGLADRARFLLDGMDLLPLTESVLT
LAETIGPPSLRSLDAIHLAAAAHVRDELTAFVTYDRRLLDGCCDVGLAVVSPGA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|