Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 1821647..1822281 Replicon chromosome
Accession NZ_CP104302
Organism Mycolicibacterium brumae strain ATCC 51384

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag L2Z93_RS08855 Protein ID WP_090593180.1
Coordinates 1821901..1822281 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag L2Z93_RS08850 Protein ID WP_090593136.1
Coordinates 1821647..1821904 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L2Z93_RS08825 (L2Z93_001759) 1816869..1817297 + 429 WP_090593123.1 cellulose-binding domain-containing protein -
L2Z93_RS08830 (L2Z93_001760) 1817272..1817850 - 579 WP_090593126.1 dihydrofolate reductase family protein -
L2Z93_RS08835 (L2Z93_001761) 1817980..1819134 + 1155 WP_162562031.1 FAD-dependent oxidoreductase -
L2Z93_RS08840 (L2Z93_001762) 1819163..1820848 - 1686 WP_090593133.1 GMC family oxidoreductase N-terminal domain-containing protein -
L2Z93_RS08845 (L2Z93_001763) 1820848..1821507 - 660 WP_090593177.1 maleylpyruvate isomerase N-terminal domain-containing protein -
L2Z93_RS08850 (L2Z93_001764) 1821647..1821904 + 258 WP_090593136.1 CopG family transcriptional regulator Antitoxin
L2Z93_RS08855 (L2Z93_001765) 1821901..1822281 + 381 WP_090593180.1 type II toxin-antitoxin system VapC family toxin Toxin
L2Z93_RS08860 (L2Z93_001766) 1822324..1822554 + 231 WP_234786265.1 class I SAM-dependent methyltransferase -
L2Z93_RS08865 (L2Z93_001767) 1822551..1822967 + 417 WP_234786266.1 class I SAM-dependent methyltransferase -
L2Z93_RS08870 (L2Z93_001768) 1822941..1823237 - 297 WP_090593139.1 DUF1905 domain-containing protein -
L2Z93_RS08875 (L2Z93_001769) 1823247..1823573 - 327 WP_090593142.1 hypothetical protein -
L2Z93_RS08880 (L2Z93_001770) 1823604..1824272 - 669 WP_090593145.1 arsenate reductase ArsC -
L2Z93_RS08885 (L2Z93_001771) 1824269..1825387 - 1119 WP_090593148.1 ACR3 family arsenite efflux transporter -
L2Z93_RS08890 (L2Z93_001772) 1825384..1825641 - 258 Protein_1743 metalloregulator ArsR/SmtB family transcription factor -
L2Z93_RS08895 (L2Z93_001773) 1825530..1826438 - 909 WP_234786267.1 relaxase domain-containing protein -
L2Z93_RS08900 (L2Z93_001774) 1826681..1827250 + 570 WP_051226815.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-110)

Antitoxin

Ribbon-helix-helix protein, CopG

(3-39)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 14121.32 Da        Isoelectric Point: 8.5943

>T257517 WP_090593180.1 NZ_CP104302:1821901-1822281 [Mycolicibacterium brumae]
VRLVDSDVLIAHLRGVAPARDWLLAARAEGPLAISVVSITELIGGMVSAERREVWRLLATFRAEPVTEIIARRAGDFMRE
YRRSHTGIGLGDYLIAATADINGYEPATFNVRHFPMFKNLRPPFEF

Download         Length: 381 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9429.40 Da        Isoelectric Point: 4.5895

>AT257517 WP_090593136.1 NZ_CP104302:1821647-1821904 [Mycolicibacterium brumae]
MKRTNIYLGEAQTANLDRLADQQGISRAELIRQLLDRALSNADDSLAADLDAIDTSFGALREVDAPDRGSGSREAHLEQM
WRRTS

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References