Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 972917..973584 | Replicon | chromosome |
Accession | NZ_CP104302 | ||
Organism | Mycolicibacterium brumae strain ATCC 51384 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | L2Z93_RS04940 | Protein ID | WP_090586806.1 |
Coordinates | 972917..973348 (-) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | L2Z93_RS04945 | Protein ID | WP_090586804.1 |
Coordinates | 973345..973584 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2Z93_RS04920 (L2Z93_000981) | 968485..969504 | + | 1020 | WP_090586976.1 | alcohol dehydrogenase AdhP | - |
L2Z93_RS04925 (L2Z93_000982) | 969563..970222 | - | 660 | WP_090586811.1 | response regulator transcription factor | - |
L2Z93_RS04930 (L2Z93_000983) | 970219..971610 | - | 1392 | WP_162561874.1 | histidine kinase | - |
L2Z93_RS04935 (L2Z93_000984) | 971607..972803 | - | 1197 | WP_090586809.1 | iron-containing alcohol dehydrogenase | - |
L2Z93_RS04940 (L2Z93_000985) | 972917..973348 | - | 432 | WP_090586806.1 | PIN domain-containing protein | Toxin |
L2Z93_RS04945 (L2Z93_000986) | 973345..973584 | - | 240 | WP_090586804.1 | antitoxin | Antitoxin |
L2Z93_RS04955 (L2Z93_000988) | 974189..975718 | + | 1530 | WP_090586801.1 | HNH endonuclease signature motif containing protein | - |
L2Z93_RS04960 (L2Z93_000989) | 975864..977516 | + | 1653 | WP_090586799.1 | arginine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15716.81 Da Isoelectric Point: 7.1714
>T257515 WP_090586806.1 NZ_CP104302:c973348-972917 [Mycolicibacterium brumae]
VKRALLDVNVLIALFDSDHVDHGRVRAWLAAEIAHGWASCAITQNGFIRIISQPRYPSPVAPAQAITRLATATSTEHHKY
WSCSISLLDADLIDHSRLHGHRQVTDAYLLALATSNDARFVTLDQSIGLNTVRNATPDNLTVI
VKRALLDVNVLIALFDSDHVDHGRVRAWLAAEIAHGWASCAITQNGFIRIISQPRYPSPVAPAQAITRLATATSTEHHKY
WSCSISLLDADLIDHSRLHGHRQVTDAYLLALATSNDARFVTLDQSIGLNTVRNATPDNLTVI
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|