Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 837827..838389 | Replicon | chromosome |
Accession | NZ_CP104302 | ||
Organism | Mycolicibacterium brumae strain ATCC 51384 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | L2Z93_RS04345 | Protein ID | WP_090589299.1 |
Coordinates | 837827..838156 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | L2Z93_RS04350 | Protein ID | WP_090589300.1 |
Coordinates | 838153..838389 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2Z93_RS04320 (L2Z93_000861) | 832939..833358 | - | 420 | WP_090589294.1 | cupin domain-containing protein | - |
L2Z93_RS04325 (L2Z93_000862) | 833876..834787 | - | 912 | WP_128111806.1 | hypothetical protein | - |
L2Z93_RS04330 (L2Z93_000863) | 835096..835761 | - | 666 | WP_090589296.1 | hypothetical protein | - |
L2Z93_RS04335 (L2Z93_000864) | 835853..836830 | - | 978 | WP_128111807.1 | hypothetical protein | - |
L2Z93_RS04340 (L2Z93_000865) | 836932..837825 | + | 894 | WP_090589298.1 | N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha- D-glucopyranoside deacetylase | - |
L2Z93_RS04345 (L2Z93_000866) | 837827..838156 | - | 330 | WP_090589299.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
L2Z93_RS04350 (L2Z93_000867) | 838153..838389 | - | 237 | WP_090589300.1 | DUF2191 domain-containing protein | Antitoxin |
L2Z93_RS04355 (L2Z93_000868) | 838476..838859 | + | 384 | WP_090589301.1 | hypothetical protein | - |
L2Z93_RS04360 (L2Z93_000869) | 838949..840181 | - | 1233 | WP_090589302.1 | hypothetical protein | - |
L2Z93_RS04365 (L2Z93_000870) | 840432..843011 | + | 2580 | WP_090589303.1 | bifunctional FO biosynthesis protein CofGH | - |
L2Z93_RS04370 (L2Z93_000871) | 843040..843378 | - | 339 | WP_128111808.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11668.60 Da Isoelectric Point: 8.1265
>T257514 WP_090589299.1 NZ_CP104302:c838156-837827 [Mycolicibacterium brumae]
MSGLPTRGEVWWCELPDIGRRPVVVISRDVAIPRTRRPLVAPCTTTIRGLPSEVQLEPGVDPVPRPSAVNLDSIESVAIG
SLVERLGRLADDRMRAICSALKVATGCGA
MSGLPTRGEVWWCELPDIGRRPVVVISRDVAIPRTRRPLVAPCTTTIRGLPSEVQLEPGVDPVPRPSAVNLDSIESVAIG
SLVERLGRLADDRMRAICSALKVATGCGA
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|