Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 306961..307522 | Replicon | chromosome |
Accession | NZ_CP104302 | ||
Organism | Mycolicibacterium brumae strain ATCC 51384 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | L2Z93_RS01540 | Protein ID | WP_090588994.1 |
Coordinates | 307178..307522 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | L2Z93_RS01535 | Protein ID | WP_090588993.1 |
Coordinates | 306961..307191 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2Z93_RS01510 (L2Z93_000302) | 302398..302769 | - | 372 | WP_234786129.1 | hypothetical protein | - |
L2Z93_RS01515 (L2Z93_000303) | 302883..303506 | + | 624 | WP_090588991.1 | class I SAM-dependent methyltransferase | - |
L2Z93_RS01520 (L2Z93_000304) | 303885..305462 | - | 1578 | WP_090589005.1 | adenylate/guanylate cyclase domain-containing protein | - |
L2Z93_RS01525 (L2Z93_000305) | 305601..306815 | + | 1215 | WP_090588992.1 | DNA polymerase III subunit delta' | - |
L2Z93_RS01535 (L2Z93_000307) | 306961..307191 | + | 231 | WP_090588993.1 | antitoxin | Antitoxin |
L2Z93_RS01540 (L2Z93_000308) | 307178..307522 | + | 345 | WP_090588994.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
L2Z93_RS01545 (L2Z93_000309) | 307586..307816 | - | 231 | WP_090588995.1 | hypothetical protein | - |
L2Z93_RS01550 (L2Z93_000310) | 307966..308717 | + | 752 | Protein_297 | MFS transporter | - |
L2Z93_RS01555 (L2Z93_000311) | 309211..312168 | + | 2958 | WP_090588996.1 | PE-PPE domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 306961..319795 | 12834 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12332.04 Da Isoelectric Point: 10.0733
>T257512 WP_090588994.1 NZ_CP104302:307178-307522 [Mycolicibacterium brumae]
MLRGEVWQVDLDPVRGSEADKRRPAVIVSNDRANATAARLGRGVVTVVPVTSNTDTVYPFQVRLSAQSGLPVESKAQAEQ
VRSVSVHRLVRRLGHVSAAEEAALDAALKLHLEL
MLRGEVWQVDLDPVRGSEADKRRPAVIVSNDRANATAARLGRGVVTVVPVTSNTDTVYPFQVRLSAQSGLPVESKAQAEQ
VRSVSVHRLVRRLGHVSAAEEAALDAALKLHLEL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|