Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PHD(antitoxin) |
Location | 207257..207919 | Replicon | chromosome |
Accession | NZ_CP104302 | ||
Organism | Mycolicibacterium brumae strain ATCC 51384 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | L2Z93_RS01035 | Protein ID | WP_090592130.1 |
Coordinates | 207524..207919 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | L2Z93_RS01030 | Protein ID | WP_090592210.1 |
Coordinates | 207257..207520 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2Z93_RS01005 (L2Z93_000201) | 202383..203411 | + | 1029 | WP_162561876.1 | ATP-dependent DNA ligase | - |
L2Z93_RS01010 (L2Z93_000202) | 203436..203945 | + | 510 | WP_193438885.1 | hypothetical protein | - |
L2Z93_RS01015 (L2Z93_000203) | 204068..205678 | + | 1611 | WP_260575493.1 | HNH endonuclease signature motif containing protein | - |
L2Z93_RS01020 (L2Z93_000204) | 205862..206878 | - | 1017 | WP_234812035.1 | S1C family serine protease | - |
L2Z93_RS01030 (L2Z93_000206) | 207257..207520 | + | 264 | WP_090592210.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
L2Z93_RS01035 (L2Z93_000207) | 207524..207919 | + | 396 | WP_090592130.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
L2Z93_RS01040 (L2Z93_000208) | 208003..208674 | - | 672 | WP_128111781.1 | hypothetical protein | - |
L2Z93_RS01045 (L2Z93_000209) | 208760..209137 | + | 378 | WP_090592138.1 | hypothetical protein | - |
L2Z93_RS01055 (L2Z93_000211) | 209333..210625 | + | 1293 | WP_090592142.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
L2Z93_RS01060 (L2Z93_000212) | 210657..212765 | + | 2109 | WP_090592146.1 | DNA polymerase III subunits gamma/tau | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 13793.84 Da Isoelectric Point: 4.4227
>T257511 WP_090592130.1 NZ_CP104302:207524-207919 [Mycolicibacterium brumae]
VAYYVDISALVKLVVAEPETPALRDWIAGESAALVSSDVTRTELLRAVRRVAPERLVEARAVLDSIILSTVSTATFEAAA
LLDPTVLRSLDAVHIAAALELGDDLAGMVTYDDRMAAAARAHGIAVLAPSQ
VAYYVDISALVKLVVAEPETPALRDWIAGESAALVSSDVTRTELLRAVRRVAPERLVEARAVLDSIILSTVSTATFEAAA
LLDPTVLRSLDAVHIAAALELGDDLAGMVTYDDRMAAAARAHGIAVLAPSQ
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|