Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 112919..113592 | Replicon | chromosome |
Accession | NZ_CP104302 | ||
Organism | Mycolicibacterium brumae strain ATCC 51384 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | L2Z93_RS00510 | Protein ID | WP_090587223.1 |
Coordinates | 112919..113344 (-) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | L2Z93_RS00515 | Protein ID | WP_090587220.1 |
Coordinates | 113341..113592 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2Z93_RS00495 (L2Z93_000099) | 108848..110701 | - | 1854 | WP_090587231.1 | galactan 5-O-arabinofuranosyltransferase | - |
L2Z93_RS00500 (L2Z93_000100) | 110703..111482 | - | 780 | WP_090587229.1 | decaprenylphospho-beta-D-erythro-pentofuranosid- 2-ulose 2-reductase | - |
L2Z93_RS00505 (L2Z93_000101) | 111512..112891 | - | 1380 | WP_090587225.1 | FAD-binding oxidoreductase | - |
L2Z93_RS00510 (L2Z93_000102) | 112919..113344 | - | 426 | WP_090587223.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
L2Z93_RS00515 (L2Z93_000103) | 113341..113592 | - | 252 | WP_090587220.1 | hypothetical protein | Antitoxin |
L2Z93_RS00520 (L2Z93_000104) | 113639..114055 | - | 417 | WP_090587218.1 | GtrA family protein | - |
L2Z93_RS00525 (L2Z93_000105) | 114096..114776 | + | 681 | WP_202971890.1 | metal-dependent phosphohydrolase | - |
L2Z93_RS00530 (L2Z93_000106) | 114867..115304 | + | 438 | WP_234786044.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
L2Z93_RS00535 (L2Z93_000107) | 115343..116539 | - | 1197 | WP_090587209.1 | helix-turn-helix domain-containing protein | - |
L2Z93_RS00540 (L2Z93_000108) | 116739..117173 | + | 435 | WP_090587206.1 | hypothetical protein | - |
L2Z93_RS00545 (L2Z93_000109) | 117307..118503 | - | 1197 | WP_090587204.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 14916.05 Da Isoelectric Point: 6.4778
>T257510 WP_090587223.1 NZ_CP104302:c113344-112919 [Mycolicibacterium brumae]
MNIVDVNVLLYAVNRQSAQHSAAHSWLSGQLRGPGTVGLSWTALLGFVRIATNPSILPRPLRPAEAFDIIDAWLASPAAV
VVEPTSRHLAILRGLLTEFGTAGNLTSDAHLAALAVEYGGVVVTFDRDFARFGVDTVTPAG
MNIVDVNVLLYAVNRQSAQHSAAHSWLSGQLRGPGTVGLSWTALLGFVRIATNPSILPRPLRPAEAFDIIDAWLASPAAV
VVEPTSRHLAILRGLLTEFGTAGNLTSDAHLAALAVEYGGVVVTFDRDFARFGVDTVTPAG
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|