Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4043325..4044007 | Replicon | chromosome |
| Accession | NZ_CP104297 | ||
| Organism | Acinetobacter baumannii strain ZHOU | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N2K92_RS19210 | Protein ID | WP_000009390.1 |
| Coordinates | 4043828..4044007 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1S2G1M8 |
| Locus tag | N2K92_RS19205 | Protein ID | WP_000878688.1 |
| Coordinates | 4043325..4043738 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2K92_RS19170 (N2K92_19185) | 4038640..4039860 | + | 1221 | WP_002067802.1 | bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ | - |
| N2K92_RS19175 (N2K92_19190) | 4040007..4041071 | + | 1065 | WP_001278262.1 | quinolinate synthase NadA | - |
| N2K92_RS19200 (N2K92_19215) | 4042202..4043056 | + | 855 | WP_071211545.1 | SH3 domain-containing protein | - |
| N2K92_RS19205 (N2K92_19220) | 4043325..4043738 | - | 414 | WP_000878688.1 | hypothetical protein | Antitoxin |
| N2K92_RS19210 (N2K92_19225) | 4043828..4044007 | - | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N2K92_RS19215 (N2K92_19230) | 4044124..4044339 | - | 216 | WP_071211544.1 | hypothetical protein | - |
| N2K92_RS19220 (N2K92_19235) | 4044349..4045398 | - | 1050 | WP_062936692.1 | phage portal protein | - |
| N2K92_RS19225 (N2K92_19240) | 4045395..4047173 | - | 1779 | WP_071211543.1 | terminase family protein | - |
| N2K92_RS19230 (N2K92_19245) | 4047351..4048211 | + | 861 | WP_071211542.1 | GPO family capsid scaffolding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4043325..4055981 | 12656 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6799.11 Da Isoelectric Point: 11.1422
>T257502 WP_000009390.1 NZ_CP104297:c4044007-4043828 [Acinetobacter baumannii]
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
Download Length: 180 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15511.84 Da Isoelectric Point: 5.2905
>AT257502 WP_000878688.1 NZ_CP104297:c4043738-4043325 [Acinetobacter baumannii]
MKYYVSIVQEEGAYIVSSRDLPLLNSVGYTLEEALSEALDGIETTFEIYMDERKAIPLPSKGKKDEYEIHLPVRVAAKVR
LYNEMISQDVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFHALGKDLDIVVA
MKYYVSIVQEEGAYIVSSRDLPLLNSVGYTLEEALSEALDGIETTFEIYMDERKAIPLPSKGKKDEYEIHLPVRVAAKVR
LYNEMISQDVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFHALGKDLDIVVA
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|