Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 2906310..2906963 | Replicon | chromosome |
Accession | NZ_CP104297 | ||
Organism | Acinetobacter baumannii strain ZHOU |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1S2G112 |
Locus tag | N2K92_RS13735 | Protein ID | WP_071210859.1 |
Coordinates | 2906310..2906699 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | N2K92_RS13740 | Protein ID | WP_001288210.1 |
Coordinates | 2906706..2906963 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K92_RS13720 (N2K92_13735) | 2901427..2903622 | - | 2196 | WP_071210860.1 | TRAP transporter large permease subunit | - |
N2K92_RS13725 (N2K92_13740) | 2903810..2904376 | - | 567 | WP_000651536.1 | rhombosortase | - |
N2K92_RS13730 (N2K92_13745) | 2904455..2905540 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
N2K92_RS13735 (N2K92_13750) | 2906310..2906699 | - | 390 | WP_071210859.1 | hypothetical protein | Toxin |
N2K92_RS13740 (N2K92_13755) | 2906706..2906963 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
N2K92_RS13745 (N2K92_13760) | 2907151..2908323 | + | 1173 | WP_071210858.1 | acyl-CoA dehydrogenase family protein | - |
N2K92_RS13750 (N2K92_13765) | 2908373..2909863 | - | 1491 | WP_016686239.1 | NAD(P)/FAD-dependent oxidoreductase | - |
N2K92_RS13755 (N2K92_13770) | 2910045..2910422 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
N2K92_RS13760 (N2K92_13775) | 2910441..2911448 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15690.01 Da Isoelectric Point: 10.4623
>T257501 WP_071210859.1 NZ_CP104297:c2906699-2906310 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFINFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKKLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFINFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKKLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2G112 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BQM7 |