Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2109686..2110337 | Replicon | chromosome |
Accession | NZ_CP104297 | ||
Organism | Acinetobacter baumannii strain ZHOU |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S3TWT7 |
Locus tag | N2K92_RS09960 | Protein ID | WP_000838146.1 |
Coordinates | 2110155..2110337 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0J1AAF8 |
Locus tag | N2K92_RS09955 | Protein ID | WP_000966689.1 |
Coordinates | 2109686..2110090 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K92_RS09940 (N2K92_09955) | 2104719..2105060 | - | 342 | WP_001281459.1 | phage tail protein | - |
N2K92_RS09945 (N2K92_09960) | 2105178..2109143 | - | 3966 | WP_000191304.1 | tape measure protein | - |
N2K92_RS09950 (N2K92_09965) | 2109204..2109605 | - | 402 | WP_000720591.1 | hypothetical protein | - |
N2K92_RS09955 (N2K92_09970) | 2109686..2110090 | - | 405 | WP_000966689.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N2K92_RS09960 (N2K92_09975) | 2110155..2110337 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N2K92_RS09965 (N2K92_09980) | 2110669..2111202 | - | 534 | WP_001185622.1 | hypothetical protein | - |
N2K92_RS09970 (N2K92_09985) | 2111247..2112176 | - | 930 | WP_000094300.1 | phage tail tube protein | - |
N2K92_RS09975 (N2K92_09990) | 2112284..2112496 | - | 213 | WP_000121166.1 | hypothetical protein | - |
N2K92_RS09980 (N2K92_09995) | 2112498..2112896 | - | 399 | WP_001132270.1 | hypothetical protein | - |
N2K92_RS09985 (N2K92_10000) | 2112898..2113266 | - | 369 | WP_000539752.1 | hypothetical protein | - |
N2K92_RS09990 (N2K92_10005) | 2113238..2113642 | - | 405 | WP_000248324.1 | hypothetical protein | - |
N2K92_RS09995 (N2K92_10010) | 2113651..2114019 | - | 369 | WP_000524231.1 | hypothetical protein | - |
N2K92_RS10000 (N2K92_10015) | 2114021..2114410 | - | 390 | WP_000008492.1 | hypothetical protein | - |
N2K92_RS10005 (N2K92_10020) | 2114415..2115080 | - | 666 | WP_038337351.1 | Ish1 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2084686..2135903 | 51217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T257500 WP_000838146.1 NZ_CP104297:c2110337-2110155 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14769.78 Da Isoelectric Point: 4.5000
>AT257500 WP_000966689.1 NZ_CP104297:c2110090-2109686 [Acinetobacter baumannii]
MLYPIAIERGTDTEAFGVSVPDIPGCFSAGDTLYEAIENVKEAISGHLEILAEDGEEIPLASDVSKFIDQEDYRGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDDNVGKDKRFKTRSAFLAAGAEKLLHA
MLYPIAIERGTDTEAFGVSVPDIPGCFSAGDTLYEAIENVKEAISGHLEILAEDGEEIPLASDVSKFIDQEDYRGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDDNVGKDKRFKTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S3TWT7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1AAF8 |