Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3312620..3313302 | Replicon | chromosome |
| Accession | NZ_CP104295 | ||
| Organism | Acinetobacter baumannii strain DETAB-C9 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N4Q44_RS15665 | Protein ID | WP_000009390.1 |
| Coordinates | 3312620..3312799 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1S2G1M8 |
| Locus tag | N4Q44_RS15670 | Protein ID | WP_000878688.1 |
| Coordinates | 3312889..3313302 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4Q44_RS15650 (N4Q44_15660) | 3308416..3309276 | - | 861 | WP_071211542.1 | GPO family capsid scaffolding protein | - |
| N4Q44_RS15655 (N4Q44_15665) | 3309454..3311232 | + | 1779 | WP_071211543.1 | terminase family protein | - |
| N4Q44_RS15660 (N4Q44_15670) | 3311229..3312278 | + | 1050 | WP_062936692.1 | phage portal protein | - |
| N4Q44_RS15665 (N4Q44_15675) | 3312620..3312799 | + | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4Q44_RS15670 (N4Q44_15680) | 3312889..3313302 | + | 414 | WP_000878688.1 | hypothetical protein | Antitoxin |
| N4Q44_RS15675 (N4Q44_15685) | 3313571..3314425 | - | 855 | WP_071211545.1 | SH3 domain-containing protein | - |
| N4Q44_RS15700 (N4Q44_15710) | 3315556..3316620 | - | 1065 | WP_001278262.1 | quinolinate synthase NadA | - |
| N4Q44_RS15705 (N4Q44_15715) | 3316767..3317987 | - | 1221 | WP_002067802.1 | bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3270872..3313302 | 42430 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6799.11 Da Isoelectric Point: 11.1422
>T257498 WP_000009390.1 NZ_CP104295:3312620-3312799 [Acinetobacter baumannii]
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
Download Length: 180 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15511.84 Da Isoelectric Point: 5.2905
>AT257498 WP_000878688.1 NZ_CP104295:3312889-3313302 [Acinetobacter baumannii]
MKYYVSIVQEEGAYIVSSRDLPLLNSVGYTLEEALSEALDGIETTFEIYMDERKAIPLPSKGKKDEYEIHLPVRVAAKVR
LYNEMISQDVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFHALGKDLDIVVA
MKYYVSIVQEEGAYIVSSRDLPLLNSVGYTLEEALSEALDGIETTFEIYMDERKAIPLPSKGKKDEYEIHLPVRVAAKVR
LYNEMISQDVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFHALGKDLDIVVA
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|