Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 446480..447133 | Replicon | chromosome |
Accession | NZ_CP104295 | ||
Organism | Acinetobacter baumannii strain DETAB-C9 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1S2G112 |
Locus tag | N4Q44_RS02180 | Protein ID | WP_071210859.1 |
Coordinates | 446744..447133 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | N4Q44_RS02175 | Protein ID | WP_001288210.1 |
Coordinates | 446480..446737 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4Q44_RS02155 (N4Q44_02155) | 441995..443002 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
N4Q44_RS02160 (N4Q44_02160) | 443021..443398 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
N4Q44_RS02165 (N4Q44_02165) | 443580..445070 | + | 1491 | WP_016686239.1 | NAD(P)/FAD-dependent oxidoreductase | - |
N4Q44_RS02170 (N4Q44_02170) | 445120..446292 | - | 1173 | WP_071210858.1 | acyl-CoA dehydrogenase family protein | - |
N4Q44_RS02175 (N4Q44_02175) | 446480..446737 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
N4Q44_RS02180 (N4Q44_02180) | 446744..447133 | + | 390 | WP_071210859.1 | hypothetical protein | Toxin |
N4Q44_RS02185 (N4Q44_02185) | 447903..448988 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
N4Q44_RS02190 (N4Q44_02190) | 449067..449633 | + | 567 | WP_000651536.1 | rhombosortase | - |
N4Q44_RS02195 (N4Q44_02195) | 449821..452016 | + | 2196 | WP_071210860.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15690.01 Da Isoelectric Point: 10.4623
>T257497 WP_071210859.1 NZ_CP104295:446744-447133 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFINFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKKLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFINFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKKLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2G112 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BQM7 |