Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 265897..266545 | Replicon | chromosome |
Accession | NZ_CP104292 | ||
Organism | Stenotrophomonas maltophilia strain ACYCe.8N |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | K7573_RS01185 | Protein ID | WP_165711185.1 |
Coordinates | 265897..266202 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | K7573_RS01190 | Protein ID | WP_005407703.1 |
Coordinates | 266243..266545 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K7573_RS01155 (K7573_01155) | 261851..262642 | - | 792 | WP_099523351.1 | zinc-dependent peptidase | - |
K7573_RS01160 (K7573_01160) | 262609..262887 | - | 279 | WP_005411956.1 | hypothetical protein | - |
K7573_RS01165 (K7573_01165) | 263032..263997 | + | 966 | WP_043035430.1 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
K7573_RS01170 (K7573_01170) | 263994..264725 | + | 732 | WP_005407698.1 | type III pantothenate kinase | - |
K7573_RS01175 (K7573_01175) | 264735..265589 | + | 855 | WP_005411958.1 | SPOR domain-containing protein | - |
K7573_RS01185 (K7573_01185) | 265897..266202 | + | 306 | WP_165711185.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K7573_RS01190 (K7573_01190) | 266243..266545 | + | 303 | WP_005407703.1 | putative addiction module antidote protein | Antitoxin |
K7573_RS01195 (K7573_01195) | 266803..267102 | - | 300 | WP_005407704.1 | hypothetical protein | - |
K7573_RS01200 (K7573_01200) | 267183..267590 | - | 408 | WP_165711186.1 | hypothetical protein | - |
K7573_RS01205 (K7573_01205) | 268185..268955 | + | 771 | WP_005411960.1 | DUF3011 domain-containing protein | - |
K7573_RS01210 (K7573_01210) | 268980..269327 | - | 348 | WP_005411961.1 | hypothetical protein | - |
K7573_RS01215 (K7573_01215) | 269458..270378 | + | 921 | WP_005407709.1 | arginase | - |
K7573_RS01220 (K7573_01220) | 270539..270676 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
K7573_RS01225 (K7573_01225) | 270714..270893 | - | 180 | WP_164225318.1 | hypothetical protein | - |
K7573_RS01230 (K7573_01230) | 270880..271101 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11372.08 Da Isoelectric Point: 11.2113
>T257496 WP_165711185.1 NZ_CP104292:265897-266202 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSGLRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSGLRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|