Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2826964..2827255 Replicon chromosome
Accession NZ_CP104288
Organism Stenotrophomonas maltophilia strain ACYCa.2H

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag K7568_RS13110 Protein ID WP_227860257.1
Coordinates 2827079..2827255 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag K7568_RS13105 Protein ID WP_235641949.1
Coordinates 2826964..2827065 (-) Length 34 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K7568_RS13075 (K7568_13075) 2822218..2823303 - 1086 WP_043034625.1 3-phosphoserine/phosphohydroxythreonine transaminase -
K7568_RS13080 (K7568_13080) 2823498..2824304 - 807 WP_005410184.1 FHA domain-containing protein -
K7568_RS13085 (K7568_13085) 2824430..2824705 + 276 WP_005410185.1 polyhydroxyalkanoic acid system family protein -
K7568_RS13090 (K7568_13090) 2824786..2825277 + 492 WP_012480721.1 phasin family protein -
K7568_RS13095 (K7568_13095) 2825515..2826525 + 1011 WP_227860256.1 restriction endonuclease -
K7568_RS13100 (K7568_13100) 2826672..2827001 - 330 WP_235641951.1 type II toxin-antitoxin system HicB family antitoxin -
K7568_RS13105 (K7568_13105) 2826964..2827065 - 102 WP_235641949.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
K7568_RS13110 (K7568_13110) 2827079..2827255 - 177 WP_227860257.1 type II toxin-antitoxin system HicA family toxin Toxin
K7568_RS13115 (K7568_13115) 2827335..2828249 - 915 WP_005407612.1 IS110-like element ISStma6 family transposase -
K7568_RS13120 (K7568_13120) 2828485..2829213 - 729 WP_043034622.1 histidine utilization repressor -
K7568_RS13125 (K7568_13125) 2829242..2830612 - 1371 WP_043034621.1 formimidoylglutamate deiminase -
K7568_RS13130 (K7568_13130) 2830680..2831903 + 1224 WP_043034684.1 imidazolonepropionase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2827335..2828249 914


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-51)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-27)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6845.92 Da        Isoelectric Point: 10.6021

>T257491 WP_227860257.1 NZ_CP104288:c2827255-2827079 [Stenotrophomonas maltophilia]
MKSRDLIRDLEAACWICRRIRGSHHVFVHPQHPHIITVPQPRKDLGKGWYRRCGSSQD

Download         Length: 177 bp

Antitoxin


Download         Length: 34 a.a.        Molecular weight: 3545.12 Da        Isoelectric Point: 5.5724

>AT257491 WP_235641949.1 NZ_CP104288:c2827065-2826964 [Stenotrophomonas maltophilia]
MRYPVLIEAGDERTAWGVVVPDLPGVLLGGRHA

Download         Length: 102 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References